KEGG   Acinetobacter pittii: BDGL_000952Help
Entry
BDGL_000952       CDS       T01684                                 

Definition
(RefSeq) putative general secretion pathway protein G precursor
  KO
K02456  general secretion pathway protein G
Organism
acc  Acinetobacter pittii
Pathway
acc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BDGL_000952
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acc02044]
    BDGL_000952
Secretion system [BR:acc02044]
 Type II secretion system
  General secretion pathway protein [MD:M00331]
   BDGL_000952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N_methyl fn3_4
Motif
Other DBs
NCBI-GeneID: 11639133
NCBI-ProteinID: YP_004995220
UniProt: F0KMC7
Position
1001376..1001930
Genome map
AA seq 184 aa AA seqDB search
MKSQSPLKSQKGFTLIEVMVVIVIMTIMTSLVVLNIGGVDQKKAMQARELFLLDMHKISK
ESLDQSRVLALSTISETDVSPFSYELYEYHDQSKLQVQDLKNRWQKYSEFNTRQLPKHVS
FTIQPLDEQNYSKATNTDLIGGQAPQLIWFGNGEAKTVKIQFYFEQKPIGSEIQIDHLGK
INEI
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctcaatcaccacttaaatcccaaaaaggttttactctcatagaagtgatggtg
gtgattgttattatgacgattatgacctctctagttgtactcaacataggtggggttgac
caaaagaaagcgatgcaagcaagagagttatttttgcttgatatgcataagattagtaaa
gagtcgcttgatcagtctcgtgttttagctttatctactatcagtgaaacagatgtttca
ccattttcttatgaattgtatgagtatcacgatcagagtaaattacaggtccaagattta
aaaaatcgctggcagaaatattctgagtttaatacacgtcagttgcctaaacatgtatcg
tttacaatacaacctttagatgagcaaaactattcaaaagctacgaataccgatttaatt
ggagggcaggctccccagttaatctggttcggtaacggtgaagctaaaactgtgaaaata
cagttttactttgaacaaaaaccaattggttcagaaatacaaattgatcatttgggtaaa
ataaatgaaatctaa

DBGET integrated database retrieval system