KEGG   Acinetobacter pittii: BDGL_000960Help
Entry
BDGL_000960       CDS       T01684                                 

Definition
(RefSeq) hypothetical protein
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polyketide_cyc2
Motif
Other DBs
NCBI-GeneID: 11639141
NCBI-ProteinID: YP_004995228
UniProt: F0KMD5
Position
1007308..1007748
Genome map
AA seq 146 aa AA seqDB search
MRNVITVEKEFNAPLTDVFNLLSKHSTYNTAFAPLQVVRVKDSADSKRPDGLGSIRRMGF
GPIKPLKEEITLLEENKSIEYKLIDNPLIKHHLGRIEFSEITPYITLVTYRIELTAKAPV
VSKLILAQLKLAITLGFSRLAKAFAS
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatgtaattaccgtagaaaaagaatttaatgctcctctgactgatgtatttaat
ttgctctctaagcattcaacttacaatactgcttttgcacctttacaagttgtgcgtgtt
aaagactccgcagattctaaaagacctgatggtttaggctcaattcgacgtatgggattt
ggtccaattaagccacttaaagaagaaattacattgttggaagaaaataaaagtattgag
tataaattaatagacaatcctttgattaaacaccatttaggtagaatcgagttttctgag
attactccatacattactttagttacataccgcatcgagttaacggcaaaagcgccagtg
gtcagtaaattaatccttgcacagttaaaactagccattacactaggcttttcgagatta
gctaaagcatttgcttcttag

DBGET integrated database retrieval system