KEGG   Acinetobacter pittii: BDGL_000963Help
Entry
BDGL_000963       CDS       T01684                                 

Gene name
himD
Definition
(RefSeq) integration host factor (IHF),beta subunit, site specific recombination
  KO
K05788  integration host factor subunit beta
Organism
acc  Acinetobacter pittii
Brite
DNA replication proteins [BR:acc03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    BDGL_000963 (himD)
Chromosome and associated proteins [BR:acc03036]
 Prokaryotic Type
  Nucleoid associated proteins
   IHF (integration host factor)
    BDGL_000963 (himD)
DNA repair and recombination proteins [BR:acc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Facilitator
      BDGL_000963 (himD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DNA_binding
Motif
Other DBs
NCBI-GeneID: 11639144
NCBI-ProteinID: YP_004995231
UniProt: F0KMD8
Position
1010381..1010683
Genome map
AA seq 100 aa AA seqDB search
MTTEALNKSDLIERIALKNPHLAEPLVEEAVKIMIDQMIEALSTDNRIEIRGFGSFALHH
RDPRVGRNPKTGKSVEVAAKAVPHFKPGKALRDAVNESGK
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgactactgaagctcttaataagtctgatttgattgaacgcattgcgctaaaaaaccca
cacttagctgaacctttggtggaagaggcggttaaaattatgattgatcaaatgatagaa
gcactatcaactgataatcgaattgaaatccgtggttttggtagctttgctttacaccac
cgtgatccaagagttggtcgcaatcctaaaacaggaaaatcagttgaagttgcagctaaa
gctgttccacattttaaacccggaaaagcccttcgtgacgcagtaaacgaatctgggaaa
taa

DBGET integrated database retrieval system