KEGG   Acinetobacter pittii: BDGL_000965Help
Entry
BDGL_000965       CDS       T01684                                 

Gene name
pyrF
Definition
(RefSeq) orotidine-5'-phosphate decarboxylase (OMP decarboxylase)
  KO
K01591  orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
acc  Acinetobacter pittii
Pathway
acc00240  Pyrimidine metabolism
acc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BDGL_000965 (pyrF)
Enzymes [BR:acc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     BDGL_000965 (pyrF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase Phytochelatin_C
Motif
Other DBs
NCBI-GeneID: 11639146
NCBI-ProteinID: YP_004995233
UniProt: F0KME0
Position
1011252..1011950
Genome map
AA seq 232 aa AA seqDB search
MEESLLSIIVALDAKSQYDALKIVEQLDPALCRVKVGKELFTHEGPSVVKKLQEQNFEVF
LDLKFHDIPNTTAQAVCAAADLGVWMVNVHASGGRKMMETCVERLKAGNYQTQLIAVTVL
TSMGREDLKDIGLDIEPVEHVKRLANLTKESGLDGVVCSAQEAKILRELIGQDFSLVTPG
IRPEGSNADDQKRIVTPKQAMLDGSTHLVIGRPITKAEKPTEMLKSILASIA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagtctcttgagtatcattgttgcgttagatgcaaaaagccaatatgacgct
ttaaaaattgttgaacagcttgatcctgctttatgccgcgtaaaagtaggtaaagagctt
tttactcatgaaggcccatctgttgtaaaaaaactgcaagaacaaaattttgaagttttt
cttgatcttaaatttcatgatattccaaacactacagctcaagcagtatgtgcagcggct
gatttaggtgtctggatggtaaatgttcacgcttcaggtggccgtaaaatgatggaaacc
tgtgtggagcgtttaaaagcgggtaactatcaaacccaacttattgctgtgacagtactc
acatcaatgggtcgtgaagatttaaaagatattggtttagatattgaacctgtagagcat
gtaaagcgcttggctaatttaacgaaagaaagtggcttggatggggtagtttgttcagct
caagaagctaagattcttcgtgaattaattgggcaagacttctctttagtaacacctggt
attcgtccagaaggttctaatgcagacgaccaaaaacgtattgtaactccaaagcaagct
atgcttgatggctctacgcatctggtaattggtcgaccgattactaaagcagaaaagcca
acagaaatgttgaagtctattcttgcttcgattgcctaa

DBGET integrated database retrieval system