KEGG   Acinetobacter pittii: BDGL_000967Help
Entry
BDGL_000967       CDS       T01684                                 

Definition
(RefSeq) putative flavin-binding monooxygenase
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMO-like Pyr_redox_3 Pyr_redox_2 K_oxygenase NAD_binding_8 NAD_binding_9 DAO Amino_oxidase Lycopene_cycl FAD_binding_2 HI0933_like Thi4
Motif
Other DBs
NCBI-GeneID: 11639148
NCBI-ProteinID: YP_004995235
UniProt: F0KMV1
Position
complement(1012896..1014443)
Genome map
AA seq 515 aa AA seqDB search
MRAILFSAYAGFPMLNAKQDAIQKTKIAIIGAGFGGLAMAIRLLQNQQQDFVILEKSNDV
GGTWRENRYPGAACDVQSHMYSLSFAPKTDWTKRYAEGPEIFNYIQDITQKYKIKDYCKF
NHDVTHVQYDETRHVWTLDFKDQPSIEAQFVVFASGPLHIPQIPPIKGIEKFKGKVFHSS
KWEHDYDLNGKSVASIGTGGSAIQYIPEIAKDVKQLYVFQRTAAWVIPRDERKYSSLSKA
LFKSSNIYRQIHRSRLYWSNESRVVPIVQPQIMKYGQKLAEAFIRFQVKDKELAKKLTPD
FVMGCKRILISNKYFPTFNRKNVELVTDSIQEIKENSIVTKDGRERPIDCLIYGTGFITD
PRIYLKHFTCIGRNQIELKQAWKDGAESYYGIMTKNFPNLFQLVGPNTVLGHNSIIFMIE
SQVNYILQLIQLVEESGQKAIEIKPEIQDAFNERVQKQLQGTVWQAGGCSSWYQSADGRN
FSLWPTYTWKYWLETRKVKPKDYLLLNKSSQSYAA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtgcaatcctcttttcagcttatgcagggtttccaatgctaaacgcaaagcaagat
gctattcaaaaaactaaaattgctattattggtgctggctttggtggcctagcaatggca
atccgtttactacaaaatcaacagcaagactttgttattttagaaaaatcaaatgatgtc
ggtggaacttggcgagaaaatcgttatccaggtgcagcatgtgatgttcaatctcacatg
tattcattgtcttttgcaccaaaaacagattggacaaaacgctatgctgagggaccagag
atctttaattatattcaagacattacacagaaatataaaattaaggattactgtaaattt
aaccatgacgtaactcatgtccaatatgatgaaacacgtcatgtctggactctagatttt
aaggaccaaccttctatagaagctcaatttgtagtttttgcatctggtcccctacacatc
ccacaaattcctcctatcaaaggaattgaaaaatttaaaggaaaagtatttcattcctca
aaatgggaacatgactatgacttaaacggaaagtcagtcgcatctattggtacaggtggt
agcgcaattcaatatattcctgaaatagccaaagatgttaaacagctctatgtatttcaa
agaacagctgcatgggtaataccacgagatgagcgcaaatattcaagcttaagtaaagca
ttattcaaatcttctaatatttatcgccagattcatcgtagtcgtctttactggagtaat
gaatctcgcgttgtgccgattgttcaacctcaaatcatgaagtatggccaaaaattggca
gaagcattcatccgttttcaagttaaggataaagagttagcaaaaaaactcacacctgac
ttcgttatggggtgtaaacgtattcttatctcaaataaatactttcctacctttaaccga
aaaaatgttgagctagtaactgatagtattcaagagatcaaagaaaatagtattgttact
aaagatggtcgagaacgacctattgattgtttaatttacggtacaggttttattactgac
ccacgtatttatttaaaacatttcacatgtatcggacgtaatcaaatcgagttaaaacaa
gcatggaaagatggtgctgaaagctattacggcattatgactaaaaactttcccaaccta
ttccaactagtaggccctaatacagttctaggccataattcgattatttttatgattgaa
tctcaagtaaattacattttacagcttattcagttagtagaagagtctggtcaaaaagca
attgagatcaagcctgaaattcaagacgcctttaacgaacgtgttcaaaagcagctgcaa
ggaaccgtatggcaagctggcggctgtagtagttggtatcaatctgccgatggtagaaac
ttttcactatggccaacttacacatggaagtattggttagaaacacgtaaagttaagccc
aaagactacttacttttaaataaaagctcacaaagctatgcagcttaa

DBGET integrated database retrieval system