KEGG   Acinetobacter pittii: BDGL_000969Help
Entry
BDGL_000969       CDS       T01684                                 

Gene name
yhcM
Definition
(RefSeq) putative ATPase
  KO
K06916  cell division protein ZapE
Organism
acc  Acinetobacter pittii
Brite
KEGG Orthology (KO) [BR:acc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acc03036]
    BDGL_000969 (yhcM)
Chromosome and associated proteins [BR:acc03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BDGL_000969 (yhcM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFG1_ATPase AAA_14 LPD5
Motif
Other DBs
NCBI-GeneID: 11639150
NCBI-ProteinID: YP_004995237
UniProt: F0KMV3
Position
1015665..1016807
Genome map
AA seq 380 aa AA seqDB search
MLNLKSSHSTAFTPSSPAERYAEALASGQFMADEAQAQAVQELDRVWKELLNRYKASKKA
FRRFRRQTSPKGVYMWGGVGRGKTWLMDQFYESVPFRRKTRMHFHHFMQHVHKELNKLSG
QRNPLEIVADQIYKDAVVICFDEFFVSNVTDAMILSDLFQKLFVRGVTLIATSNIAPDGL
YKNGIHRDRFLPTIEMVKKNCAVLNVDAGVDYRLRVLKQAQLFKSPLTNEAQSWMAERFS
ALTHTQAHSQEPIVINNRVVETLGHTEDVLWCEFSELCFKPRSPADFIEIANIYNTVLVS
NVPHLTDFLSEGTRRFIYLVDEFYDRGVKLLLTSQDSIIDIYQGEKLAFEIERTRSRLLE
MQSDEYLHSEHRHIDATKTS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatttaaaatcttctcatagtactgcattcacaccttcttccccagcagaacgc
tatgctgaggctttagcttcaggtcaatttatggcagatgaagcgcaagcacaggcagtg
caagaattagatcgcgtatggaaagaacttttaaaccgttataaagcctcaaaaaaagct
ttccgtcgtttccgtcgccaaacttcacctaaaggtgtatatatgtggggcggagtaggc
cgtggaaaaacttggctgatggatcaattttatgaatctgtgccatttcgccgtaaaacg
cgtatgcattttcatcatttcatgcaacatgttcataaagagctaaataagctttctggc
caacgtaatccacttgaaatcgtagctgaccaaatctataaagatgctgtcgttatttgt
tttgatgaattctttgtctcaaacgtaacagatgcaatgatcttaagcgatttattccaa
aaattatttgtgcgtggtgtgacattaattgcaacatcaaacattgcaccagatggctta
tataaaaacggtattcaccgtgatcgtttcttgccaaccattgaaatggttaaaaagaac
tgtgctgttttaaatgtagatgcaggtgtggactatcgtttgcgtgtactaaaacaagct
caattattcaaatcaccattaacgaatgaagcacaaagctggatggctgaacgttttagt
gctttaacccatacacaagctcattctcaagagccgattgtgattaataatcgtgttgtc
gagactctggggcatacagaagatgtgttgtggtgtgagttttctgaactctgctttaaa
ccacgtagcccagcagattttattgaaattgcaaatatttataatacggttctagtcagt
aatgttcctcatttgacggatttcttatctgaaggtactcgtcgctttatttatctagtc
gatgagttttacgatcgaggtgtgaaattacttttaacgtcccaagatagtattattgat
atttatcaaggtgaaaagttagcatttgagattgaacgtacgcgttcacgtttgctagaa
atgcagtctgatgaatatttacattctgaacaccgacatattgatgctacaaaaacctct
taa

DBGET integrated database retrieval system