KEGG   Acinetobacter pittii: BDGL_000970Help
Entry
BDGL_000970       CDS       T01684                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
acc  Acinetobacter pittii
Pathway
acc00620  Pyruvate metabolism
acc00630  Glyoxylate and dicarboxylate metabolism
acc01100  Metabolic pathways
acc01110  Biosynthesis of secondary metabolites
acc01120  Microbial metabolism in diverse environments
acc01200  Carbon metabolism
Module
acc_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BDGL_000970 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BDGL_000970 (glcB)
Enzymes [BR:acc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BDGL_000970 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 11639151
NCBI-ProteinID: YP_004995238
UniProt: F0KMV4
Position
1017177..1019342
Genome map
AA seq 721 aa AA seqDB search
MTARIQKGKLAIAKELYDFIENEALPGSGLDSETYWKNFEQVVVDLSPKNKALLAKRDEL
QAKIDEWHRNNKFELGAYKAFLTEIGYLLPEVEDFQITTENVDEEIALLAGPQLVVPVRN
ARYCLNAANARWGSLYDALYGFDVISEEGGAEKGKGYNPVRGAKVIEFAKNFLNEVFPLA
QGSHADATKYAIEQNKLVVTLKDGSKTGLAHEAQFVGFNGEEANPSEVVLLSNGLHVIIE
IDANSPIGQTDPAGVKDLTFEAAVTTIQDLEDSVAAVDAEEKVEGYRNWLGLMKGTLQES
IEKNGKTIVRDLNKDREIKNLIGGTTKLHGRSLMLLRNVGHLMTNPAILVDGEEIFEGIM
DALVTPLLSIADIRSTNENKNSRKGSMYIVKPKMHGPEEVAFAVELFERAEQAIGLPPKS
LKIGIMDEERRTSVNLKNCIAAAKDRTIFINTGFMDRTGDEIHTSMEAAPVVRKEAVKTQ
KWIAAYENRNVAIGLKCGLQGKAQIGKGMWPKPDSMKDMLATKAAHPNAGASCAWVPSPT
GAVLHAMHYHQVNVKARQDQLKAEEMLSLDDLLTPPFAPDTNWSAEEINNELENNCQGIL
GYVVRWVDLGVGCSKVPDINNVGLMEDRATLRISSQHVANWLRHGIVTREQVEEVLKRMA
KIVDEQNANDPLYKPMASNFETNIAFQAASDLIFKGCEQPSGYTEPLLHAARLKLKGYTG
D
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacgtattcaaaaaggcaagttagcgattgctaaagaactttacgattttatc
gaaaatgaagctttaccaggttctggtttagatagtgaaacttactggaagaactttgag
caagttgttgtcgatcttagcccaaaaaataaagcattattggctaagcgtgatgaatta
caagcaaaaattgatgagtggcaccgtaacaacaaatttgaattaggtgcttataaagcg
ttcttaactgaaattggttatttattaccagaagttgaagattttcaaatcactactgaa
aatgtagatgaagaaattgcgttgttggcaggaccacagttagttgtacctgtacgtaat
gcacgttattgcttaaatgcagcaaatgcccgttggggttctttatatgatgcactttac
ggcttcgatgtaatttctgaagaaggcggagctgaaaagggtaaaggatataatcctgtt
cgtggtgcaaaagttattgagttcgctaagaatttcttaaatgaagttttcccgcttgct
caaggttcacatgcagatgcaacaaaatatgcaattgagcaaaataaactcgttgtaact
ttgaaagatggttcaaaaacaggtttagctcatgaagctcagtttgttggtttcaatggt
gaggaagcaaatccttcagaagttgtacttttaagtaatggtcttcatgtcattatcgaa
attgatgcaaatagcccaattggacaaactgatccagcgggtgttaaagatttaacattt
gaagcggcagtaaccacaattcaagatttggaagactctgttgcggctgtcgatgcagaa
gaaaaagttgaaggttaccgtaactggttaggtttaatgaagggtacacttcaagaatct
attgaaaagaatggtaaaacgattgttcgtgatctaaataaagatcgcgaaattaaaaac
ttaattggtggtacaacaaaacttcatggtcgttcacttatgttacttcgtaacgtaggt
cacttaatgactaacccagctattttggtagacggcgaagaaatttttgaaggtattatg
gatgcattggtaactccattgttatcaattgctgatattcgtagtacaaacgaaaataaa
aactctcgtaaaggttctatgtatattgttaagccaaaaatgcatggtcctgaagaagtt
gcgtttgctgtagagttatttgaacgtgctgaacaggcgattggattaccacctaaatcg
ttaaaaatcggtattatggatgaagagcgccgtacgtctgtaaacttgaaaaactgtatt
gctgctgctaaagaccgtacaatctttattaatactggctttatggaccgtacgggtgac
gaaatccatacttctatggaagctgcgccagttgttcgtaaggaagctgttaaaacacaa
aaatggattgctgcttacgaaaaccgtaacgttgcaattggcttgaaatgtggtttacaa
ggtaaagcacagattggtaaaggcatgtggccaaagccagatagcatgaaggatatgtta
gcaactaaagctgcacatccaaatgctggtgcttcatgtgcttgggttccatctccaact
ggtgctgtacttcacgcgatgcattaccatcaagtgaatgtaaaagcacgtcaagatcag
ttaaaagctgaagaaatgttgtcattagatgacttgttaactcctccatttgcacctgat
acaaattggtcagcggaagagattaacaatgaacttgaaaataactgccaaggtatctta
ggttatgttgttcgttgggttgacttaggtgtaggttgttcgaaagttcctgatattaac
aacgtgggcttaatggaagaccgtgcaacattacgtatttcttctcaacacgttgctaac
tggttacgtcacggtattgtaactcgtgaacaagttgaagaagtgcttaaacgtatggca
aaaattgttgatgagcaaaatgcgaatgacccattgtataaaccaatggcatctaacttt
gaaacaaatattgctttccaagcagcttctgaccttatcttcaaaggttgtgaacagcct
tctggttacactgagccgttacttcatgctgctcgtttgaagttaaaaggttatacaggt
gattaa

DBGET integrated database retrieval system