KEGG   Acinetobacter pittii: BDGL_000976Help
Entry
BDGL_000976       CDS       T01684                                 

Gene name
btuB
Definition
(RefSeq) TonB-dependent receptor
  KO
K02014  iron complex outermembrane recepter protein
Organism
acc  Acinetobacter pittii
Brite
KEGG Orthology (KO) [BR:acc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acc02000]
    BDGL_000976 (btuB)
Transporters [BR:acc02000]
 Other Transporters
  Pores ion channels [TC:1]
   BDGL_000976 (btuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_dep_Rec Plug OMP_b-brl_3
Motif
Other DBs
NCBI-GeneID: 11639157
NCBI-ProteinID: YP_004995244
UniProt: F0KMW0
Position
complement(1022576..1025206)
Genome map
AA seq 876 aa AA seqDB search
MMCLTLAQAAETEQSSTDEKPTKVVKVAVTGSSIKGVAAQSASPITIVKVDEILKQGVTT
TEEALAKISANQSSFVTAQNVGASGTVGSAADLRGIGANKTLILLNGRRLAANAYDSGVT
NLNIIPLAMLDRIEVLRDGASAIYGTDAIGGVINFITKKQFTGLNISGGLTQPEQNGGDT
QDVSVFGGYGDLDENGFNIFGVVDYRHGNDVMAKDRKVSKRGGLLPELGITKGSSGSFPA
NFYDTKTGTEGNPYAATGCGSNPLVYAQGGFCRYNSQAVIGIVPKTEDISALGRATFKLN
DNLNAVAEYVYARNEITTSVAPDVFFDLTLNPDSKYYPGNGITPPMNKVSGPLELYIRSQ
AGNRVSSSINESHRVFGGLEGEAFGWDINTGVTYAHSEAEDRLNSGYLNYNRTQEALNNG
ILNPFGPQAPEDAGLWDTLGVTGAYLKADVDSTTVDFTASRPIFTLPAGDVGFAIGASYR
HDEWTSNVVPEVASQAPSTGVDPDEPTNKGKRDIKAVFTELHIPLHKTLEAQLAARYDDY
SDFGDTFNPKFALRWEPIKQLMFRTSYSTGFRAPTLWEVNAPNSITNTSAYYNDPVLCPN
GPPKNPGDTLPPGGVASRDCETQFDRKNGGNKDLDPEESKSFTAGLVLEPIKNLVLTLDY
FNIEVENQIAALPESDIFNNPTKYADKFVRNPDGTLNHIITTQDNMGDLKTSGVDVSLNY
ITPMTATGRFGFGIDGTYVIKYKYQNEKDGEWISSLGTYVGDAPIIRWKHTANLYWNYQN
WGVNFQQQFTRGYDDQNSSSSVAEGYRDHKVSDYTIYNISGTYKGFKNLEVTAGIKNIFD
EDPPASNVGDNFQMGYDPRYADPLGRTYFVRGTYKF
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgtcttaccctggcacaggcagcagaaactgaacaatcaagtactgatgaaaaa
ccaacaaaagtcgtaaaagttgccgttacaggttcttcaatcaaaggagttgcagcacaa
agtgcttcccccattaccatcgtaaaagttgatgaaatcttaaaacaaggggtaacaaca
acagaggaagcattagcaaagatcagtgcaaaccaatcaagttttgttactgctcaaaat
gtaggtgctagtggaacggtaggctccgcagctgacctccgaggaattggtgccaataaa
accttaatcttacttaatggtcgtcgtttagctgcaaatgcttatgatagtggtgtcact
aatttaaatattattccgctagctatgttagaccgtattgaggtcttacgagatggcgca
tcagcaatttatggtacagatgcaattggtggtgtaatcaacttcattactaaaaaacaa
tttactggtttaaacatcagtggaggtttgacacaaccagagcaaaatgggggggataca
caagatgtaagtgtatttggtggttatggtgatcttgatgaaaatggcttcaatatcttt
ggtgtcgttgattatcgacatggcaacgatgttatggctaaagatcgtaaagttagtaaa
cgcggaggattattaccagagttaggtattacaaaaggtagcagtggtagttttcctgct
aacttttatgacacaaaaactggtaccgaaggaaacccatatgcagctacaggctgtgga
agtaatccgctcgtgtacgctcaaggtggattctgccgttataacagtcaagcagtgatt
ggaattgttccaaaaactgaagatatctcagcattggggcgtgctacttttaagctaaat
gacaatttaaatgctgtagcagaatatgtttacgcacgtaatgaaattactacttctgtc
gctccagacgttttcttcgatttaacattgaatcctgatagtaaatattatccaggtaat
ggaattacacctcctatgaataaagtcagtggcccacttgaactttatattcgttctcaa
gctggtaatcgtgttagttctagtattaatgagtcacatcgtgtattcggtggtctagag
ggtgaagcattcggttgggatattaatactggtgttacttatgctcatagcgaagcggaa
gatcgattaaatagtgggtatcttaactacaacagaactcaagaagctttaaataatggt
attttaaacccattcggtccacaagcaccagaagatgcaggcttatgggatacattagga
gtaactggtgcttatttaaaagcagatgttgattcaactactgttgatttcactgctagt
cgacctatatttacattaccagcaggtgacgttggttttgcaataggagctagctatcgc
catgatgaatggacctcaaacgtggtgcctgaagtggctagtcaagcaccaagtacaggg
gttgatcctgatgaacctacaaataaaggaaaaagagatattaaagcagtctttactgaa
ctgcatattccattacataaaacattagaagctcaacttgcagcccgttacgatgattac
agtgatttcggagatacgtttaatcctaaattcgcacttcgctgggaaccaattaaacaa
ttaatgtttcgtacctcttatagcacaggatttagagcaccaactttatgggaagtaaat
gctcctaactctataacaaatacttcagcttactataatgatcctgtactttgtccgaat
ggccctcctaaaaatccaggagatactcttccacctggtggtgttgccagccgtgattgc
gaaacccaatttgatcgcaaaaatggaggaaataaagatcttgatcctgaagaatcaaaa
tcatttactgctggcctagttcttgaaccaattaagaatttagttctaaccttagattat
tttaatattgaagttgaaaatcaaattgctgcattacctgagagtgatatttttaacaat
ccaacaaaatatgccgacaagttcgtacgcaacccagatggaacgcttaaccatatcatt
actactcaagacaatatgggtgatttaaaaacttctggtgtcgatgtaagtctaaattat
ataaccccaatgacagcaacaggtcgatttggttttggaatcgatgggacttatgtcatt
aaatataaatatcaaaatgaaaaagatggagaatggattagtagtttaggcacatatgtt
ggagatgccccaattattcgttggaaacatactgctaatttatactggaattatcaaaac
tggggtgtaaatttccaacaacaattcactcgtggttacgatgaccaaaattcaagttct
tctgttgcggaaggttatcgtgatcataaagtaagcgactatacaatttataatatttca
ggcacatacaaaggctttaaaaatctagaagttacagcaggtattaagaatatctttgat
gaagaccctcctgcttcaaatgttggtgacaacttccaaatgggatatgacccacgttac
gcagatcctttaggacgtacttactttgtacgaggtacatataagttctaa

DBGET integrated database retrieval system