KEGG   Acinetobacter pittii: BDGL_000977Help
Entry
BDGL_000977       CDS       T01684                                 

Definition
(RefSeq) hypothetical protein
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2220
Motif
Other DBs
NCBI-GeneID: 11639158
NCBI-ProteinID: YP_004995245
UniProt: F0KMW1
Position
complement(1025811..1025933)
Genome map
AA seq 40 aa AA seqDB search
MEKQSQKTQSFVTTENKANFMPFINIHHKIINNIRNSYFY
NT seq 123 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacaaagtcaaaaaacccaatcttttgtaactactgaaaataaagcgaatttc
atgccatttattaatattcatcacaaaataattaataatattagaaattcatatttttat
tag

DBGET integrated database retrieval system