KEGG   Acinetobacter pittii: BDGL_000982Help
Entry
BDGL_000982       CDS       T01684                                 

Gene name
appC
Definition
(RefSeq) ABC transporter permease
  KO
K02034  peptide/nickel transport system permease protein
Organism
acc  Acinetobacter pittii
Pathway
acc02024  Quorum sensing
Module
acc_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:acc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BDGL_000982 (appC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acc02000]
    BDGL_000982 (appC)
Transporters [BR:acc02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    BDGL_000982 (appC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N
Motif
Other DBs
NCBI-GeneID: 11639163
NCBI-ProteinID: YP_004995250
UniProt: F0KMW6
Position
1032687..1033829
Genome map
AA seq 380 aa AA seqDB search
MLSVLSKRKQQTKAEAHSSGLWKLAMRRLRADKIAMSSLVIVLLYFIILVLSMTGVIASD
WNKEVAVSYAPPTFIGADKTTDAGQKAAAIEEELPENPVDPLKDVIDKLKAEIKQEKSSG
SAIDYYGVVDPLADDMKAIDQQLGGHLLDQQAELKSTLVFGADKWGQDVLKKTIKGAETS
IIVGVISALLAVGIGTLLGAISGYFGGWVDDILNWFYNIFTSIPYLLLVLAIAAVLQQKG
ILSIVLILGLTGWTGVYRLIRAEYMKHTAREYVLAAKAIGVGHFRRMFIHIFPNVSHIAL
VQMSILVVSFIKSEVILSFLGFGVPVGVVSWGSMLNEAQSELLLGKWWQLVAASVAMAVL
VTAFSMFTDALRDALDPKLK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcgttttatcaaaaagaaaacaacaaacaaaagccgaagctcattcatctggc
ctgtggaaacttgccatgcgtcgtcttcgggccgacaagatcgcaatgtcatcgctagtg
attgtattgctttattttattatcttggttctatcaatgacgggcgtgattgcatctgac
tggaataaagaggtagccgtaagttatgcaccgcctacatttataggggcagataagaca
acagatgcagggcaaaaggcggcagcgattgaagaagagttaccagaaaatccagtcgat
cctttaaaagatgtaattgataagcttaaggctgaaattaaacaagaaaagagctctgga
agtgcaattgattattatggtgtagttgacccattagccgatgatatgaaagcgatcgat
cagcaacttggaggacatttacttgatcaacaagcagaactgaaaagcacccttgtgttt
ggagctgataaatggggacaggacgttttaaagaaaactattaaaggtgctgaaacttca
attattgttggggtgatatcggctttacttgcagtaggaattggtacacttttaggcgca
atttctggatatttcggtggttgggttgatgatattctcaactggttttataacattttt
acctcaattccatatttgttattagttctcgcgattgctgcagtacttcaacaaaaaggc
attctatctattgttctgattttgggtttaacgggctggacaggtgtttatcgattaatt
cgtgccgagtatatgaaacacactgcacgtgagtacgttcttgctgccaaagcaattggt
gttggtcacttccgccgtatgttcattcatatttttccaaatgtcagccatattgcttta
gtccagatgtcaattttggtggtgtctttcattaaatctgaggtcatcttgagtttctta
ggctttggtgtaccagtaggcgtagtgtcttggggaagcatgttaaatgaagcacaaagt
gaacttcttttaggtaagtggtggcaacttgtcgcagcctctgtcgcaatggctgttttg
gttacggcattttcaatgtttactgatgcacttcgtgatgcgttagatccaaagctaaaa
taa

DBGET integrated database retrieval system