KEGG   Acinetobacter pittii: BDGL_000983Help
Entry
BDGL_000983       CDS       T01684                                 

Gene name
gsiA
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
acc  Acinetobacter pittii
Pathway
acc02024  Quorum sensing
Module
acc_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:acc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BDGL_000983 (gsiA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acc02000]
    BDGL_000983 (gsiA)
Transporters [BR:acc02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    BDGL_000983 (gsiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N oligo_HPY AAA_21 AAA_22 AAA_29 AAA_16 TniB Mg_chelatase ResIII ABC_ATPase AAA_18
Motif
Other DBs
NCBI-GeneID: 11639164
NCBI-ProteinID: YP_004995251
UniProt: F0KMW7
Position
1033842..1035575
Genome map
AA seq 577 aa AA seqDB search
MLEQENKNAPLLHVKNLRVSFKGEDKQYIETVKGITFDIPANTTVALVGESGSGKSVTSL
ATMGLLPVGQSKIDEQSKIIFEGKDLLSLSRKDMRKICGKDIAMIFQEPMSSLNPVFTVG
NQIAEVLCLHMGLSRKQARQRVLELLKEVGIPSPETKIDAYPNQLSGGQQQRVMIAMAIA
CEPKLLIADEPTTALDVTIQKQIIDLLESLRKRRQMSMLFITHDLALVGEIADKVIVMRH
GEIREQGAAEEVLEQPKDVYTRALLYCRPQMSQRPYRLPVTSDFMRQEDDVLVEQSFDAS
EIPERKRGLIGDEKIILEVKDLKKSFYSRKGLFGKEEFQAVKGVSFKLAKGKTLGLVGES
GSGKTTVGLLLMRLHQASGGQAFIEGKDILSLTEKEFAKYQRKIQIIFQNPYASLNPRFT
IGQILLEPMQIHNIGKDDAERKQIALGLLERVNLPEQAYYRYPHEFSGGQRQRIAIARCL
TLKPEILICDESVSALDVSVQAQVLNLLQDLQDEFGLSYIFISHDLSVVKYISDQVMVMN
HGEVVEIANSDELYAHPQHDYTKRLLKAIPQGIQHIS
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaagaaaataagaatgcgccgttactgcatgttaaaaatttacgagtaagt
tttaaaggtgaagataagcaatatattgaaaccgtaaaaggaattacttttgatattcct
gcaaatactacggttgctttagtaggtgagtcgggtagtggtaaatcggttacttctttg
gcaactatgggattgctgcctgtaggtcagagtaaaattgatgagcaaagtaaaattata
tttgaaggcaaagatttattgagcttatctcgtaaagatatgcgcaaaatctgtggtaaa
gatattgcgatgatttttcaggagccgatgtcatcattaaatcctgtttttacagttggc
aaccaaattgcagaagtgttgtgtttgcatatggggttgagccgtaaacaggctcgacaa
cgcgttctagagttgcttaaagaagtaggtattccttcacctgaaactaaaattgacgcc
tatccaaatcaactttcgggtggtcaacagcaacgtgtcatgattgcaatggcgattgcg
tgtgagcctaaactgctcattgccgatgagccgactacggcacttgatgtaacgatccaa
aagcaaattattgatttactcgagtcattacgtaaacgtcgtcaaatgtcgatgcttttt
attacccacgatttagcattggttggtgaaattgcagataaagttattgtgatgcgtcat
ggtgagattagagagcaaggtgctgctgaagaggttcttgaacagcctaaagatgtatat
acgagagctttgctctattgtcgcccgcaaatgtcacaaagaccttatcgtttgcctgtg
acgagcgattttatgcgtcaagaagacgatgtattggtcgaacaaagttttgatgcttca
gaaattcccgagcgcaaacgtggcttaattggtgatgagaaaattatcttagaagtaaaa
gacctgaaaaaaagcttttatagtcgtaagggtctatttggcaaagaagagtttcaggcc
gtaaaaggagtttcttttaagctggctaagggaaaaactttgggtttagtcggagagtct
ggatcaggtaaaacgactgttgggctattactcatgcgcttacatcaggcatctggtggg
caggctttcatcgaaggtaaagatattctttcattaactgaaaaagagtttgctaaatat
caacggaaaatccagatcatctttcaaaatccctatgcgtctcttaatccacgctttacc
attggacagattttattagagcctatgcaaattcataacattggtaaagatgatgcagag
cgtaaacaaattgcccttggactgcttgagcgagtgaatctgcccgaacaagcttactac
cgatatccacatgagttctcgggtgggcaacgtcaacgtattgccattgcacgctgttta
acgctaaagcctgaaattttgatttgtgatgaatctgtttctgcgctagatgtttcagtc
caagcgcaggtacttaacttattacaagatttacaagatgagtttgggctcagctacatc
tttatttcacatgacttatcggttgtgaagtatatctctgatcaggtcatggtcatgaat
catggcgaggttgtagaaatagccaattcagatgaactctatgcacatcctcaacatgat
tatactaaacgactattaaaggcgattcctcaagggattcaacacatttcatga

DBGET integrated database retrieval system