KEGG   Acinetobacter pittii: BDGL_000984Help
Entry
BDGL_000984       CDS       T01684                                 

Definition
(RefSeq) hypothetical protein
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRAP
Motif
Other DBs
NCBI-GeneID: 11639165
NCBI-ProteinID: YP_004995252
UniProt: F0KMW8
Position
1035608..1036342
Genome map
AA seq 244 aa AA seqDB search
MPFYLVYVVNAYKIKEVNVEYFILVMCANFKPLTLAQLQQLQLPVVGFSYAEEVYPAGTM
PLLFESPQGLEWREVMFGLVPKWAEDTNIAKHTYNARHETIFQKPSFQEAALKCKFGVIP
VTEFYESKYINDKPERWGVRRKDGQAFFIAAIYEICKINETIIRSASMLTMDAIDHPMMK
DFHEPGDVKRSVIVIPHERLDEWLSLETPDISSFIEGFPVEEFECSHVPKEKIIKPTPQL
SMFD
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgcctttttatttggtttatgtggtaaatgcttataaaataaaagaagtaaatgtagag
tattttattcttgttatgtgcgctaattttaaacctttaacgcttgcccaattacagcaa
cttcagttgcctgtggtcggctttagctatgccgaagaggtttatcctgcaggaacaatg
ccactattatttgaatcaccacaagggcttgagtggcgtgaagtgatgttcggattggtt
cctaaatgggctgaagatacaaatatagcaaaacatacctacaatgcccgccatgagact
attttccaaaaacctagctttcaagaagccgcacttaaatgtaaattcggtgtgattcca
gtgaccgaattttatgaaagtaagtatataaatgataaacctgagcggtggggtgttcgc
cgtaaagatgggcaggcttttttcatcgcagcaatctatgaaatttgcaaaataaatgaa
acgattattcgttctgcaagcatgttgacgatggatgctatagaccatccgatgatgaaa
gattttcatgagccaggcgatgttaaacgatcagttattgtgattccacatgaacgacta
gatgaatggttaagtttagaaacaccagatatttccagctttatcgaaggctttccagtt
gaagagtttgaatgctctcatgtaccaaaagaaaaaattataaaacctacaccacagtta
agtatgtttgactaa

DBGET integrated database retrieval system