KEGG   Acinetobacter pittii: BDGL_000985Help
Entry
BDGL_000985       CDS       T01684                                 

Definition
(RefSeq) hypothetical protein
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 11639166
NCBI-ProteinID: YP_004995253
UniProt: F0KMW9
Position
complement(1036402..1036770)
Genome map
AA seq 122 aa AA seqDB search
MMLYGYHFSTIEHNWEDLKPLNEFLQTFADDDGDVSTRDKESLKEIIAKSDTALALAREM
GWDGSYTGCPYLFWLPSKNSQSFEYGFVFKQTSDNTTFVISPIELSYLAEDSEVQTLSKN
IE
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgatgctatatggatatcatttctcaacaatagaacataactgggaagaccttaagccc
ttaaatgagtttctacaaacatttgcagatgatgatggtgatgtttcaacacgagataaa
gaatctctcaaagaaatcatagcgaaatctgatacagctttagctctcgctagagaaatg
ggttgggatggtagttatacaggctgtccttatctattctggttacccagtaaaaatagc
caatcttttgagtatggctttgtatttaaacagacctcagataatacaacttttgtgatt
tcaccgattgaattgagctatttagctgaagactctgaggtacaaacattaagtaaaaat
attgaataa

DBGET integrated database retrieval system