KEGG   Acinetobacter pittii: BDGL_000989Help
Entry
BDGL_000989       CDS       T01684                                 

Gene name
yraR
Definition
(RefSeq) oxidoreductase
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HIM1 Semialdhyde_dh 2Fe-2S_thioredx NRBF2_MIT
Motif
Other DBs
NCBI-GeneID: 11639170
NCBI-ProteinID: YP_004995257
UniProt: F0KMX3
Position
1039299..1039916
Genome map
AA seq 205 aa AA seqDB search
MGLALVEQLEQTPEFEAITVVVRKESQLLNTYKKVTQLVIEDFLLLNDEDVNGHTHAFSC
LGTTLKLAGSKQAFYAVDYEINAHLADLVQDKHIHLLLVSALGANANSPIFYNKVKGQLE
DYIESLELEKLSIFRPSLLIGKRSDVRFIEDLGQSLFKLIENKFQKPFKYKPVTAEQLAH
TMVVAALTQIEAFKRYDNLSIQQTR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgggtttagcgcttgtcgaacagcttgagcaaacaccagaatttgaagcgattactgtt
gtggtgagaaaagaatcacaactacttaatacatataaaaaagttactcaactcgttata
gaggattttttattactcaatgatgaagatgtgaatggccatacccatgcatttagctgt
cttggaacaacattaaaattggcaggctcaaaacaggctttttacgctgtggattatgaa
atcaatgctcatttagcagatttagtacaagataaacatattcatctattgctagtgagt
gcccttggagcaaatgcaaattctccaattttctataataaagtgaaaggacaattagaa
gattatattgagagtctagaactcgaaaaactatctatttttagaccatctttactgatt
ggtaaacgcagcgatgtacggtttattgaagacttagggcagagtctatttaaacttatt
gagaataaatttcaaaagccattcaaatataagccagtaactgctgagcaattggctcat
acgatggtcgtagcggcgctaacgcaaattgaagcctttaaacgatatgataatctgagc
atacaacaaactcgataa

DBGET integrated database retrieval system