KEGG   Acinetobacter pittii: BDGL_000990Help
Entry
BDGL_000990       CDS       T01684                                 

Gene name
menG
Definition
(RefSeq) ribonuclease activity A regulator
  KO
K02553  regulator of ribonuclease activity A
Organism
acc  Acinetobacter pittii
Brite
Messenger RNA biogenesis [BR:acc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     BDGL_000990 (menG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RraA-like
Motif
Other DBs
NCBI-GeneID: 11639171
NCBI-ProteinID: YP_004995258
UniProt: F0KMX4
Position
1039929..1040435
Genome map
AA seq 168 aa AA seqDB search
MSTVPFVTCDLLDDNPEKDLQVVIPSMDGKFFQSYGARKTFGGQVVTVKCFEDNSRVKEL
LATDGTGKVLVVDGGASMRCALMGDLIAESAVKNNWNGVVIYGCVRDVDALATLDLGVHA
LAAIPQKSNRKGIGEVDINLYFGGVTIQSGDFIYADNNGIVIAKEKLV
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgacagtaccatttgtaacatgtgatttattagatgataaccctgaaaaagactta
caggttgtaatcccatcaatggatggcaagttctttcaaagttatggagctcgtaaaact
tttgggggacaggttgtaacagtaaagtgctttgaagataactcacgtgtaaaagagtta
ttggcaacagatggtacaggtaaagtattagttgtggatggtggtgcatctatgcgctgt
gcactcatgggggatttgattgctgaatcagcggttaaaaataattggaatggtgtagtg
atttacggttgtgtaagagatgttgatgcacttgcgaccttagatttgggagtacatgca
ttggctgcaattccacaaaaaagtaatcgtaagggcattggtgaagtagatattaatttg
tattttggtggagtcacaattcaatctggtgattttatctatgctgataataatgggatt
gtgatagcaaaagaaaaattagtctaa

DBGET integrated database retrieval system