KEGG   Acinetobacter pittii: BDGL_000995Help
Entry
BDGL_000995       CDS       T01684                                 

Definition
(RefSeq) hypothetical protein
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HIT DNA_pol_viral_N
Motif
Other DBs
NCBI-GeneID: 11639176
NCBI-ProteinID: YP_004995263
UniProt: F0KMX9
Position
1046549..1046983
Genome map
AA seq 144 aa AA seqDB search
MFSLHPQLAQDTFFVGDFPLSTCRLMNDMQFPWLILIPRVPGITELYELSQADQEQFLRE
SSWLSSQLSRVFRADKMNVAALGNMVPQLHFHHVVRYQNDVAWPKPVWGTPAVPYTNDVL
AHMRQTLMLALRGQGDMPFDWRMD
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtttagtttgcatccacaacttgctcaagatactttttttgtaggcgattttccgctt
tcaacatgtcgtttaatgaatgatatgcaattcccttggctgattttaatccctcgtgtg
ccgggaatcacagaactatatgagttgagccaagctgaccaagaacagtttttacgtgaa
tcaagttggttatctagccagctatctcgcgtattccgtgctgataaaatgaatgttgca
gctttggggaatatggtgcctcaattgcatttccatcatgtggtacgttatcagaatgat
gttgcatggcctaaaccagtatgggggacacctgcggttccttatacaaatgatgtgctg
gctcatatgcgtcaaactcttatgcttgcgttacgtggtcaaggtgatatgccatttgat
tggcgcatggactaa

DBGET integrated database retrieval system