KEGG   Acinetobacter pittii: BDGL_001948Help
Entry
BDGL_001948       CDS       T01684                                 

Gene name
idh
Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
acc  Acinetobacter pittii
Pathway
acc00020  Citrate cycle (TCA cycle)
acc00480  Glutathione metabolism
acc01100  Metabolic pathways
acc01110  Biosynthesis of secondary metabolites
acc01120  Microbial metabolism in diverse environments
acc01200  Carbon metabolism
acc01210  2-Oxocarboxylic acid metabolism
acc01230  Biosynthesis of amino acids
Module
acc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:acc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BDGL_001948 (idh)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BDGL_001948 (idh)
Enzymes [BR:acc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BDGL_001948 (idh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-GeneID: 11640140
NCBI-ProteinID: YP_004996216
UniProt: F0KKH1
Position
complement(2107910..2109052)
Genome map
AA seq 380 aa AA seqDB search
MGADGKQYDAKAVMPESTFARIYQEMINFCKWHGNFDPKTMGTVPNVGLMAQKAEEYGSH
DKTFEISEAGIANITDLDTGEVLLTQNVEEGDIWRMCQVKDAPIRDWVKLAVTRARNSGM
PAIFWLDPYRPHENELIKKVQKYLKDHDTTGLDIQIMSQVRAMRYTLERVVRGLDTISVT
GNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENHLRWD
SLGEFLALAVSLEEMGIKENNARAKLLAKTLDEATGKLLDNDKSPSRRTGEIDNRGSHFY
LSLYWAEALAAQNEDAELKAKFAPLAKALAENEEKIVAELAQVQGKPADIGGYYAIDPTK
VNAVMRPSATFNAALATVEA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgctgatggtaagcagtatgatgctaaagctgttatgccagaatcaacatttgcc
cgtatttaccaagaaatgatcaacttctgtaagtggcatggtaacttcgatccaaagact
atgggtacagtaccaaacgttggtttgatggctcaaaaagctgaagaatacggttctcac
gataagacttttgagatttcagaagctggtattgcaaacattaccgatcttgacactggt
gaagtattattgactcaaaatgtggaagaaggcgatatctggcgtatgtgtcaggttaaa
gatgctccgattcgtgactgggttaaacttgcagtaactcgtgcacgtaactcaggcatg
cctgcaatcttctggcttgacccgtaccgtccacacgaaaacgaattgatcaagaaagta
caaaagtacttaaaagatcatgatacgactggtcttgatatccaaatcatgtctcaagta
cgtgcaatgcgttacacacttgagcgcgtagtacgtggcctagacacgatttctgtgact
ggtaacatcttacgtgactacttaactgacttgttcccaattatggaacttggtacttct
gcaaaaatgttgtctatcgttccgctaatggcgggtggtggtatgtacgaaactggtgca
ggtggttcagcgccaaaacacgtacaacaacttgttgaagaaaaccacttacgttgggat
tcacttggtgagttccttgcgcttgcagtatctttagaagaaatgggtattaaagaaaat
aatgctcgtgctaagttacttgcgaagacacttgatgaagcgactggtaaattgcttgac
aatgacaagtctccatcacgtcgtactggtgaaatcgataaccgtggcagccacttctac
ttgtcactttactgggctgaagcacttgctgctcagaacgaagatgctgagttgaaagct
aaatttgctcctcttgctaaagctttagctgaaaatgaagagaagattgttgctgaactt
gctcaagtacaaggtaaaccagcggacatcggtggttactacgcaattgacccaactaaa
gtaaatgctgtaatgcgtccaagtgctacatttaatgcagctcttgcaacagttgaggct
taa

DBGET integrated database retrieval system