KEGG   Acinetobacter pittii: BDGL_003033Help
Entry
BDGL_003033       CDS       T01684                                 

Gene name
fadB1
Definition
(RefSeq) putative enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
acc  Acinetobacter pittii
Pathway
acc00071  Fatty acid degradation
acc00280  Valine, leucine and isoleucine degradation
acc00281  Geraniol degradation
acc00310  Lysine degradation
acc00360  Phenylalanine metabolism
acc00362  Benzoate degradation
acc00380  Tryptophan metabolism
acc00410  beta-Alanine metabolism
acc00627  Aminobenzoate degradation
acc00640  Propanoate metabolism
acc00650  Butanoate metabolism
acc00903  Limonene and pinene degradation
acc00930  Caprolactam degradation
acc01100  Metabolic pathways
acc01110  Biosynthesis of secondary metabolites
acc01120  Microbial metabolism in diverse environments
acc01130  Biosynthesis of antibiotics
acc01212  Fatty acid metabolism
Module
acc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BDGL_003033 (fadB1)
   00650 Butanoate metabolism
    BDGL_003033 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    BDGL_003033 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BDGL_003033 (fadB1)
   00310 Lysine degradation
    BDGL_003033 (fadB1)
   00360 Phenylalanine metabolism
    BDGL_003033 (fadB1)
   00380 Tryptophan metabolism
    BDGL_003033 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BDGL_003033 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BDGL_003033 (fadB1)
   00281 Geraniol degradation
    BDGL_003033 (fadB1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BDGL_003033 (fadB1)
   00627 Aminobenzoate degradation
    BDGL_003033 (fadB1)
   00930 Caprolactam degradation
    BDGL_003033 (fadB1)
Enzymes [BR:acc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BDGL_003033 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 11637680
NCBI-ProteinID: YP_004997301
UniProt: F0KJC4
Position
3255427..3256200
Genome map
AA seq 257 aa AA seqDB search
MQWQSILLEKRNGVGLITLNRPQALNALNSELISEINQALDQLEKDREIGCIVLAGSEKA
FAAGADIKEMADLAFPDIYLDDFFHLADRIAQRRKPLIAAVSGYALGGGCELALMCDFIY
CADNAKFGLPEITLGVIPGIGGTQRLTHAIGKAKAMEMCLTARQMGAVEAEQSGLVARVF
TKEELLEQTLQAAEKIAARSLTANMMLKETINRAFEVNLTEGLRFERRMFHSIFATFDQK
EGMQAFVEKRKPNFKNQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggcaaagtattttattagaaaagcgtaatggagttggactgattacattaaat
cgccctcaagcgctcaatgccttaaacagtgaattaattagtgaaattaatcaggcatta
gatcagctcgaaaaagatcgtgaaattggctgcatcgtattggcaggctcagaaaaagct
tttgccgcaggagctgacattaaagaaatggctgatttggcatttcctgatatttattta
gatgacttttttcatcttgcagatcgtattgcacagcgccgtaaacctctaattgcagcg
gtgagtggctatgcattgggtggtggctgtgagttggcgctgatgtgtgattttatttat
tgtgctgataacgccaagtttggtttacccgaaatcactttaggggtgattccgggtatt
ggtggcacacaacgcttaactcatgcgattggtaaagccaaagcaatggaaatgtgcctt
accgctcgtcaaatgggcgctgtagaagcagagcaaagtggtttagtcgcgcgtgtgttt
actaaagaagaattacttgaacaaaccttgcaagccgctgaaaaaatcgcagcacgctct
ttaactgcaaacatgatgcttaaagaaaccattaaccgagcttttgaagtaaaccttact
gaaggcttacgctttgaaagacgtatgttccattcaatttttgcaacatttgaccaaaaa
gaaggaatgcaggcgttcgttgaaaaacgaaaaccaaattttaaaaatcaataa

DBGET integrated database retrieval system