KEGG   Acinetobacter oleivorans: AOLE_00755Help
Entry
AOLE_00755        CDS       T01263                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00010  Glycolysis / Gluconeogenesis
acd00020  Citrate cycle (TCA cycle)
acd00620  Pyruvate metabolism
acd01100  Metabolic pathways
acd01110  Biosynthesis of secondary metabolites
acd01120  Microbial metabolism in diverse environments
acd01130  Biosynthesis of antibiotics
acd01200  Carbon metabolism
Module
acd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOLE_00755
   00020 Citrate cycle (TCA cycle)
    AOLE_00755
   00620 Pyruvate metabolism
    AOLE_00755
Enzymes [BR:acd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AOLE_00755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H HlyD_D23 RnfC_N TFX_C HlyD_3 CAT
Motif
Other DBs
NCBI-ProteinID: ADI89054
UniProt: D8JLF0
Position
169796..171763
Genome map
AA seq 655 aa AA seqDB search
MQIKTPDIGVDKAVVAEILVKVGDSIAENDSLVLLESDKASVEVPSTSAGVVKSILIKEG
DSVTEGTVLFELEAEGAAPVAQTEEVAKPAPAAEQTAAPAAVQQTSTAAQPAAATTSQVV
EVQVPDIGVEKALVGEILVKVGEQIDIEQSIVVVESDKATVEVPSSVAGTVESIQVKEGD
TVKEGVVLIKVKTTSASSAPVEAPASTAAAAPAPVQKETVATAATQSGPVDINVPDLGVD
KAVVAEILVQVGDKVDVDQSLVVVESDKATVEVPSTVAGIVKAIHLQAGQQVSQGILLAT
IEAEGQAPAAAKAEVAPAPQAAAPKAAAPAPTQAVSAPASGSDKLTKEQEAENAKVYAGP
AVRKLARELGVILSQVKTSGEHGRVVKEDIFAYVKTRLTAPQAAPVAAAAPAVSGLPKLP
DFTAFGGVEEKVLTRLQQVSIPQLSLNNFIPQVTQFDLADITELEDWRNELKGNFKKEGI
SLTIMAFIIKAVAYLLKEEREFAGHLSDDGKSVLLRNEIHMGIAVATPDGLTVPVLRNPD
QKSIKQIAVELGVLGQKARDKKLTPKDLQGANFTISSLGAIGGTAFTPLVNWPQVAILGI
SPATMQPVWNGKDFDPRLMLPLSLSYDHRVINGADAARFTNKLTKLLKDIRTLLI
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaagacccctgatattggtgtagataaagcagttgttgctgaaattttggta
aaagttggtgacagcattgctgaaaatgacagccttgttttacttgagtcagataaagca
tctgttgaagtgcctagcacttcagcaggtgtcgtaaaaagtatcttaatcaaggaaggc
gatagcgtaactgaaggtacggtattgtttgaacttgaggctgaaggtgctgcacctgta
gctcaaacagaagaagttgcaaaacctgctccagcagctgaacaaacagcagcgccggca
gcggtacaacagacttcaactgctgcacaacctgcagcggcaaccactagccaagtggtt
gaagttcaagttcctgatattggtgttgaaaaagcactcgttggtgaaatcttagtaaaa
gttggtgagcaaatcgatattgagcaaagcatcgttgttgttgaatctgacaaagcaact
gtagaagtaccaagtagtgttgcgggtactgtagaaagcattcaagttaaagaaggcgat
acagttaaagaaggtgttgtgctcattaaagtgaaaacaacatctgcatcgagtgcgcca
gttgaagctcctgcttctacagcagcggcagcgcctgcaccagttcaaaaagaaactgta
gctacggctgctactcaatctggaccagttgatattaacgttcctgatttgggcgtagat
aaagcagttgttgctgaaatcttggttcaggttggcgataaagttgatgtagaccaaagc
cttgttgtggttgagtcagataaagcgactgttgaagttccaagtactgttgcgggcatt
gtgaaagcgattcacttgcaagcaggccaacaggtttcacaaggtatattgcttgcaaca
attgaagctgaaggccaagcacctgctgcggcaaaagcagaagtagctccagctccacag
gcagcagcacctaaagcggcagctcctgctccgactcaggctgtatctgctccagcgtct
ggcagtgacaagttaactaaagagcaagaagccgaaaacgctaaagtatatgcaggtcct
gctgtacgtaagcttgctcgtgaacttggtgtgattttgtcacaagttaaaacttctggt
gagcatggccgtgttgttaaagaagatatctttgcttatgtgaagactcgtttaactgcg
ccacaagctgcaccagttgctgcggctgcaccagcggtttcgggtttaccaaagcttcct
gacttcactgcgtttggtggagtggaagaaaaagtactgacgcgtttgcagcaagtatca
attccgcaattgtcgttgaataactttattccgcaagtcactcagtttgatttggctgac
attactgagttagaagattggcgtaatgaactgaaaggcaacttcaaaaaagaaggtatc
agcctgacgattatggcattcattatcaaagcagttgcgtatttgttaaaagaagagcgt
gagttcgcaggtcatctatctgatgacggtaaatcagtgctcttgcgcaatgaaatccat
atgggaattgcggtagcaacacctgatggtttaactgtgccagtacttcgtaacccagac
caaaaatcaattaagcaaatcgcagttgaattgggtgtgttaggtcaaaaagcacgtgat
aagaaattaacaccgaaagacttacaaggtgcgaatttcaccatttcaagcttaggcgca
attggtggtacagcatttacaccacttgtaaactggccacaagttgcgattttgggtatt
tcacctgcaacgatgcaaccggtttggaatggtaaagactttgatccacgcttaatgttg
ccgttgtcgttgtcttatgatcaccgtgtaattaatggtgcagatgccgctcgatttacc
aataaacttacgaaacttcttaaagatattcgtactttattaatctaa

DBGET integrated database retrieval system