KEGG   Acinetobacter oleivorans: AOLE_00840Help
Entry
AOLE_00840        CDS       T01263                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00010  Glycolysis / Gluconeogenesis
acd00620  Pyruvate metabolism
acd00640  Propanoate metabolism
acd00680  Methane metabolism
acd01100  Metabolic pathways
acd01110  Biosynthesis of secondary metabolites
acd01120  Microbial metabolism in diverse environments
acd01130  Biosynthesis of antibiotics
acd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOLE_00840
   00620 Pyruvate metabolism
    AOLE_00840
   00640 Propanoate metabolism
    AOLE_00840
  Energy metabolism
   00680 Methane metabolism
    AOLE_00840
Enzymes [BR:acd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AOLE_00840
Lipid biosynthesis proteins [BR:acd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AOLE_00840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADI89071
UniProt: D8JLG7
Position
189742..191691
Genome map
AA seq 649 aa AA seqDB search
MNEIYPVPEEFKKTARTVEADYFKRYQNSIENPDEFWAEQAKIVDWIKPFTQVKNTSFDK
DNFKIEWFADGELNVSANCLDRHLKEHPHKPAIIWEGDHPSRHKIVSYKELHDEVCRFAN
VLKKYGIGKGDRVVLYMPMVTEAAIAMLACARIGAVHCVVFGGFSPDSLASRIEDSQAKL
VITADSSLRAGKLLPLKENVDLALELPGTECVENVVVVYRNANPIEMKPGRDLWYHLIIM
EVDANCPPEPMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYVTSTFKEVFDLKQDDVYW
CTADVGWITGHSYLIYGPLANGTTTLMFEGVPQYPTWARLGHVVDKHKVSILYTAPTAIR
AMMREGDSFVRESNRSSLRLLGSVGEPINPEAWNWYYNVVGEGRCPIVDTWWQTETGGIL
IAPLPGATALKPGSATRPLFGVQPAIVDGEGNELEGAAEGNLVIKDSWPGQMRTIWGDPD
RFIEAYFSTFKNTYFTGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHEAV
AEAAVVGMPHDIKGQGICTFVTLQAGVPESEELRKELINWVRKVLGPVASPDALHWAPAL
PKTRSGKIMRRILRKIAANELDSLGDTSTLAEPAVVDQLIATVYPDKQN
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagatctatccagtaccagaggaatttaaaaaaacagctcgtactgttgaagca
gactattttaaacgttatcaaaactctatcgagaacccagatgaattctgggcagagcaa
gctaaaattgtcgattggataaagccatttacccaagttaaaaatacgagttttgacaaa
gacaatttcaagattgaatggtttgctgatggtgagttgaatgtgtcagcaaactgccta
gacaggcatcttaaagaacaccctcataaacctgcaattatttgggaaggtgaccatcct
tctcgtcataaaattgtctcgtataaagaattacacgacgaagtctgccgttttgccaac
gttttaaagaaatatggcattggtaaaggtgaccgtgttgtgctgtatatgccgatggtc
actgaggctgcgattgccatgttagcctgtgcccgtattggtgctgttcactgcgtggtg
tttggtgggttctcgccagactctttagcaagtcgtattgaagatagccaagctaaactg
gtgattaccgcagactcaagtctacgtgccggaaaactattaccactcaaagaaaatgtc
gatttggctctagagttgccgggcacagagtgtgttgaaaatgtagtggtggtttaccgt
aatgcgaacccgattgaaatgaaaccgggccgtgatttgtggtatcacctcattattatg
gaagtagatgccaactgtcctccagaaccgatgaaggctgaagacccattatttattctc
tatacctcgggctcgacaggtaaaccgaaaggtgttttgcataccacaggtggttattta
gtatatgtaacaagtacctttaaagaggtctttgatttaaaacaagatgatgtgtactgg
tgtacggcagatgtaggttggattacaggtcatagttatctgatctatggcccacttgca
aatggtacgacgaccttaatgtttgagggtgtgcctcaatatccaacatgggcacgtctt
ggtcatgtggtcgataagcacaaagtctctattttatatacagcgccaactgcgattcgc
gccatgatgcgagaaggtgattcgtttgtacgtgaaagtaaccgtagcagcctgcgttta
cttggttcggtcggtgagcctattaaccctgaagcttggaattggtactacaacgttgtt
ggtgaaggccgctgcccgattgttgatacatggtggcaaaccgaaacaggcggtattttg
attgctccattgccgggtgcaacagctttaaaaccgggttctgcaacacgtccgttattt
ggtgttcaacctgccattgtagatggtgaaggcaatgagctggaaggtgcggctgaaggt
aacctagtcattaaagattcatggccgggccagatgcgtactatttggggtgatcctgat
cgctttattgaagcgtatttctcgacctttaaaaatacctattttacaggtgatggtgct
cgtcgtgatgaagatggctattactggattacaggtcgagttgacgatgtcttgaacgtt
tcaggccatcgtttaggtacggctgaaattgaaagtgctctggtgtcacatgaagccgtg
gcagaagctgcggtggtgggtatgccgcatgatattaaaggacaaggtatttgtactttt
gtgactctacaagcgggtgttccagagtcggaagaattgcgtaaagagttaatcaactgg
gtacgtaaagtactcgggccagtagcttcaccagatgcactacattgggcaccagcatta
cctaaaacgcgttcgggtaaaatcatgcgccgtattttaagaaagattgcggcaaatgaa
ttagatagtttaggtgatacttcaactttggctgaacctgctgtggtagatcagttaatt
gcaacggtttatcccgataagcaaaactaa

DBGET integrated database retrieval system