KEGG   Acinetobacter oleivorans: AOLE_01465Help
Entry
AOLE_01465        CDS       T01263                                 

Definition
(GenBank) 23S ribosomal RNA G745 methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
acd  Acinetobacter oleivorans
Brite
KEGG Orthology (KO) [BR:acd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:acd03009]
    AOLE_01465
Enzymes [BR:acd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     AOLE_01465
Ribosome biogenesis [BR:acd03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AOLE_01465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_32 PCMT Ubie_methyltran MTS TPMT Methyltransf_9 Methyltransf_12 NodS Methyltransf_4 PrmA Methyltransf_18 tRNA_U5-meth_tr Methyltransf_8 DREV FtsJ Methyltransf_29 Pox_MCEL CMAS BILBO1_N
Motif
Other DBs
NCBI-ProteinID: ADI89196
UniProt: D8JM78
Position
324246..325049
Genome map
AA seq 267 aa AA seqDB search
MCPVCRQSLDLNEKTWRCGQGHSYDVAKQGYVNLHVVQHKHSKNPGDTPESVDARRAFLQ
GGYYQPLQHAVVALLKQLDVKTVLDIGCGEGYYTSAMQQVVEQCVGVDIAKNAVQRAAKL
NAEVTWVVGTGATLPVLDQSMDACTSLFSPIPQAEIARVLKDDGYLIVVTPASEHLYAMR
EALFEQVNPHTPEKFVEQLQDLFELKQEQIINAPFVLDQQALKNLIAMTPYAYKASPERR
LQLEQQSQLEVMASFQIYVFQKRNKNS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcctgtgtgtcgtcagtctctcgatttaaatgaaaaaacttggcgatgtggacaa
gggcatagttatgatgtcgctaaacaaggttatgtgaacttacatgttgtgcaacataaa
catagtaagaatcctggagatacaccagagtctgtcgatgcgcgaagagcttttttacaa
ggtggttattatcagcctttacaacatgctgtagtcgctttattaaaacaattagatgta
aaaaccgtacttgatattgggtgtggtgaaggttactacaccagcgctatgcagcaagtc
gttgagcaatgtgttggtgttgatattgcaaaaaatgcggtacagcgtgcagcaaagctt
aatgctgaggtgacttgggttgtggggactggtgcgactttgcctgtgcttgatcaaagc
atggatgcatgtaccagtttgtttagcccaattccacaagcagaaattgctcgagtttta
aaggatgatggatatttaattgttgtcactcctgcatctgagcatttatatgcaatgcgt
gaagctttatttgaacaggttaaccctcatacaccagagaagtttgtggagcaattgcaa
gatttgtttgagctcaaacaagagcaaattattaatgccccttttgtgcttgaccaacag
gctttaaaaaatctgattgctatgacgccgtatgcttataaagcctctcctgagcgtcgt
ttgcagttagagcagcagtcgcaattagaggtaatggcatcttttcaaatttatgtcttt
cagaaacgtaataaaaacagctag

DBGET integrated database retrieval system