KEGG   Acinetobacter oleivorans: AOLE_03405Help
Entry
AOLE_03405        CDS       T01263                                 

Definition
(GenBank) Geranyltranstransferase(Farnesyl-diphosphate synthase)
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00900  Terpenoid backbone biosynthesis
acd01100  Metabolic pathways
acd01110  Biosynthesis of secondary metabolites
acd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acd00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AOLE_03405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:acd01006]
    AOLE_03405
Enzymes [BR:acd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     AOLE_03405
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     AOLE_03405
Prenyltransferases [BR:acd01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   AOLE_03405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ADI89580
UniProt: D8JDE3
Position
730622..731533
Genome map
AA seq 303 aa AA seqDB search
MSSLSQVNADVLKQAQQRIQQDLLTTLAAFSIPEPLKSAVHHAVMLGGKRVRPALCYATA
SLQPNPNFAAARRAAVAVELIHCYSLAHDDLPCMDNDLLRRGQPTCHVAFGEDTALLAGD
ILQSMAFEVLGSRLFDEQGQGTDAAIVLKQIQILATATSKMVCGQVLDLQAEAKQIAQDE
LENIHRNKTGALIQAAIMMGAVTIFSGTDQAIPKLRQYGQTIGLAFQVLDDILDITSSTE
ALGKTAGKDEQVQKSTYPALMGLEQAQIYAKELHDQAFEALAYFGDNAKELVEISQFLLA
RTN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcactctctcaagttaatgcggatgttttaaaacaagctcaacaacgtattcaa
caagatttattgacgacactggccgcgttctcaattccagagcctttaaaaagtgcagta
catcatgcagtcatgcttggtggaaaacgtgtgcgtccggctttgtgttatgccacagct
tctttacagcctaatccaaattttgctgcggctcgtcgtgctgcggttgctgtagagtta
attcattgttattcgctagcgcacgatgacttgccttgtatggataatgatttactgcgc
cgtggtcagccgacatgtcatgttgcatttggtgaagatactgctttactcgcaggcgat
attttacaatcaatggcttttgaagttttaggtagtcgtttgttcgatgaacaagggcag
ggtaccgatgctgcaattgtattaaaacaaattcagattttagcaacagccacttctaaa
atggtttgtggacaggtgttagacctacaagctgaagctaaacaaattgctcaagacgaa
cttgaaaatattcatcgtaataaaactggtgcgcttattcaggctgcaattatgatgggt
gcagtcactatcttttctggaacagatcaagcaattccaaaattgcgccaatatgggcag
accattggactggcttttcaagtattagacgatattctcgatattacttcgagtaccgaa
gctttgggcaaaactgctggtaaagatgagcaagttcaaaaatcgacgtacccagcttta
atggggcttgagcaagcacagatttatgctaaagaattgcatgatcaagcttttgaagct
ttagcttattttggtgacaatgcaaaagagttagttgagatttcacaattccttttagca
cgtaccaactaa

DBGET integrated database retrieval system