KEGG   Acinetobacter oleivorans: AOLE_10115Help
Entry
AOLE_10115        CDS       T01263                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00071  Fatty acid degradation
acd00072  Synthesis and degradation of ketone bodies
acd00280  Valine, leucine and isoleucine degradation
acd00310  Lysine degradation
acd00362  Benzoate degradation
acd00380  Tryptophan metabolism
acd00620  Pyruvate metabolism
acd00630  Glyoxylate and dicarboxylate metabolism
acd00640  Propanoate metabolism
acd00650  Butanoate metabolism
acd00900  Terpenoid backbone biosynthesis
acd01100  Metabolic pathways
acd01110  Biosynthesis of secondary metabolites
acd01120  Microbial metabolism in diverse environments
acd01130  Biosynthesis of antibiotics
acd01200  Carbon metabolism
acd01212  Fatty acid metabolism
acd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOLE_10115
   00630 Glyoxylate and dicarboxylate metabolism
    AOLE_10115
   00640 Propanoate metabolism
    AOLE_10115
   00650 Butanoate metabolism
    AOLE_10115
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOLE_10115
   00072 Synthesis and degradation of ketone bodies
    AOLE_10115
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOLE_10115
   00310 Lysine degradation
    AOLE_10115
   00380 Tryptophan metabolism
    AOLE_10115
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AOLE_10115
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOLE_10115
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AOLE_10115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acd04147]
    AOLE_10115
Enzymes [BR:acd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AOLE_10115
Exosome [BR:acd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOLE_10115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt PepSY_2 DUF5417
Motif
Other DBs
NCBI-ProteinID: ADI90912
UniProt: D8JK91
Position
2182806..2183978
Genome map
AA seq 390 aa AA seqDB search
MSSIVIVSGSRTAMGGFQGSLSALTAPELGAAVIRESIQRAGVAPEQVDEVIFGCVLSAG
IGQGPARQAMRKAGVPDHVGAVTINKLCGSAMKAVLMASDTLKAGSANIIVAGGMESMTN
APYILPKARGGYRMGHGEIKDHMFLDGLEDAETGRLMGSFAQDMANTKGFTREQMDNFAI
SSLKKAQTAITEGYFKEEIVPVEVKTRKGVEVIDQDEQPLKANLEKIPTLRPAFSKDGTI
TAANSSSISDGAAALVLTTEEYAQSHGLNTLAKIVATSTHSQHPSEFTIAPISAIQKVLE
RAGWSVDEVDAWEINEAFAMVAMAPIHDLGIDEAKVNVHGGACALGHPIGATGSRIILSL
IYALKRLGKKKGVAALCIGGGEATAVAIEI
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaattgttatagtttcaggtagtcgtactgctatgggcggttttcaaggcagc
ctatctgctttaactgcaccagaacttggcgcggctgtaattcgtgaatctattcaacgt
gcaggtgttgcacctgaacaagtagatgaagttatttttggttgcgtattgagtgcaggc
ataggtcaaggtcctgctcgtcaggcgatgcgtaaagctggtgtaccagatcatgtgggt
gcggtcaccattaataaactatgtggttctgctatgaaagcggtgttaatggcttcagac
accttaaaagctggtagtgccaatattattgttgcaggtggcatggaatctatgactaat
gcgccgtatattctgccgaaagctcgcggtggttaccgtatgggtcacggtgaaattaaa
gaccatatgtttttagatggtcttgaagatgctgaaacaggccgcttaatgggttctttt
gctcaagacatggcaaacaccaaaggttttacacgtgagcaaatggataactttgcgatt
tcttctttgaaaaaagcgcaaactgccattaccgaaggttacttcaaagaagagattgtt
cctgttgaagtcaaaacacgtaaaggtgtcgaagttatcgatcaagatgagcaaccatta
aaagctaatcttgagaaaattccaacattgcgtccagcttttagtaaagacggaacaatt
acagctgctaactcaagctccatttctgatggtgctgctgcgttagtacttacgactgaa
gaatatgctcaaagccatggcttaaatactttggcgaaaattgttgcaacttctactcac
tcacagcatccaagcgaatttaccattgctccaattagtgcaattcaaaaagtgcttgag
cgcgctggctggtctgttgacgaagtagatgcttgggaaattaatgaagcttttgcaatg
gtggcaatggcaccaattcatgatttaggtatcgatgaagcaaaagtcaacgtacatggt
ggtgcttgtgctttaggtcatcctattggtgcaactggctcaagaattattctttctctt
atctatgctttaaaacgcctaggtaaaaagaaaggtgttgccgcgttatgtattggtggt
ggtgaagctacagctgtcgcaattgaaatctaa

DBGET integrated database retrieval system