KEGG   Acinetobacter oleivorans: AOLE_12075Help
Entry
AOLE_12075        CDS       T01263                                 

Definition
(GenBank) NADP-dependent fatty aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00040  Pentose and glucuronate interconversions
acd00053  Ascorbate and aldarate metabolism
acd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AOLE_12075
   00053 Ascorbate and aldarate metabolism
    AOLE_12075
Enzymes [BR:acd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     AOLE_12075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADI91302
UniProt: D8JM44
Position
2594835..2596415
Genome map
AA seq 526 aa AA seqDB search
MLNITGQNFIAGQRSSSGSKFVLSYDAATDEALPYQFAQATPEEIDQAAQAAALAYPAFR
QTTPEQRAVFLETIASEIDALDDQFIATVCQETALPEARIRGERGRTTGQLRLFAQVLRR
GDYLGARIDLALPERQPLPRPDLRQYKIGVGPVAVFGASNFPLAFSTAGGDTASALAAGC
PVIVKAHSGHMATAESIANAICSAIEKCAMPKGIFSMIYGQGVGEPLVKHPAIKAVGFTG
SLKGGRALCDLAAARPEPIPVFAEMSSINPMVLLPEALKVRGDKIAAELSGSVVLGCGQF
CTNPGLIIGIKSAEFSQFLEQFTAAMAQQPPQTMLNKGTLRSYEHGLKALLAHDKIEHLA
GQPQQGHQAYPQLFKADVSLLLEQDELLQEEVFGPTTIVIEVESAEQLALALNGLRGQLT
ASLIAELQDFENFSTLIPLLEEKAGRLLLNGYPTGVEVCDAMVHGGPYPATSDARGTSVG
TLAIDRYLRPVCYQNYPDHLLPPALQNANPLGIERLVNGEMSKAAL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatattactggtcaaaattttattgcaggtcaacgttcaagttcgggcagtaaa
tttgtcttaagttatgatgctgcaacagatgaagcattaccctatcaatttgctcaagcc
actcctgaagaaattgatcaggcagctcaagcagctgcattggcttatccagcttttaga
caaaccacaccagaacagcgcgctgtttttctagaaacaattgccagtgaaattgatgcg
cttgatgaccagtttattgccactgtctgtcaagaaactgctttacctgaagctcgcatt
cgcggtgaacgtgggcgaactactggccaattacgtctgtttgctcaagtattacgccgt
ggtgattatttaggtgcccgtattgatttggctttacctgagcgtcaaccacttccacgt
ccagatttacgtcaatataaaatcggtgttgggccagtggcggtatttggtgcaagtaat
ttccctcttgccttttctactgctggtggcgataccgcttcagcacttgcagctggatgt
cctgtcattgtgaaggcgcatagcggccacatggcaaccgccgaatccattgcaaatgcg
atttgtagtgcaattgagaaatgcgctatgccaaaaggcatctttagcatgatttatggt
caaggtgttggtgaacccctggtaaaacaccctgcaattaaagcagttggatttacaggt
tcactcaaagggggccgtgctctctgcgatttagctgctgcacgccctgagccaattcct
gtttttgccgaaatgtcgagcattaacccaatggttttattacccgaagctctaaaagtg
cgtggtgataaaattgcagccgaacttagtggttcagtggttttaggttgcggtcagttc
tgtaccaatccgggtttaattattggaattaaatcagctgaatttagccaatttcttgag
cagttcacggctgcaatggctcagcaaccaccacaaaccatgcttaacaaaggcacgtta
agaagctatgaacatggtctgaaagcattactcgcacacgacaaaattgagcatttagca
ggtcaaccacagcaaggccatcaagcttatcctcagctctttaaagctgatgtatctctt
ttactagagcaggatgaactacttcaagaagaagtatttggcccaacgacgattgtgatt
gaagttgaatcggcagagcaacttgctctagcgttaaatggacttcgtggtcagcttacc
gcatcattaattgccgagctgcaagattttgagaacttctctacccttattccattactt
gaagaaaaagcaggacgtttacttctaaatggttacccaacaggtgtggaagtctgtgat
gccatggtacacggcggtccttaccctgcaacttccgatgcacgtggtacttcggtagga
accttagcaatcgaccgttatttacgaccagtatgctatcaaaactatccagatcactta
ttaccacctgcccttcaaaatgccaatccgcttggtattgaacgcttagtgaatggtgaa
atgagtaaagctgcactttaa

DBGET integrated database retrieval system