KEGG   Acinetobacter oleivorans: AOLE_12195Help
Entry
AOLE_12195        CDS       T01263                                 

Definition
(GenBank) type IV / VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
acd  Acinetobacter oleivorans
Pathway
acd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AOLE_12195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acd02044]
    AOLE_12195
Secretion system [BR:acd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AOLE_12195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU Sigma_reg_N
Motif
Other DBs
NCBI-ProteinID: ADI91326
UniProt: D8JMK1
Position
complement(2617926..2618732)
Genome map
AA seq 268 aa AA seqDB search
MSQSTGAPSLFDDGQIGTGGNNNSQSQAKLQAINLIDLLHDGFYLVFLIRNQYVPADAQQ
FREKILNLLNQFEQQAKKLQFSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNAWLISP
LQLSLFGSQLAGYRFFEILEQLRSRGKERLAALEVFHYCLLLGFQGKYRIESTESLNHLV
SRVGDEIDYLKGKKVAFSPFSAIPDQIRNIIHREVPFFWILIFLLIFALLTFAGLRFMLN
NQNDKALSNYQNVISAPQEQAHITIYLP
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaatccacaggtgctccttctttatttgatgatgggcagattggaacgggcggg
aacaataatagccagtctcaagcaaaactacaggcaatcaatcttattgatttattgcat
gacggcttttatttggttttcttgattcgaaatcagtatgtgccagcagatgctcagcaa
tttcgtgaaaaaatcttaaatttactcaatcaatttgagcaacaagccaaaaagttacaa
ttttcagctgatgatattcatgatgctaaatatgcattctgtgctttgattgatgaaacg
atcgtaacgcaacaagacccaagttattttaatttgcaaaatgcttggttaattagcccg
ttacaattgagcttgtttggttctcagttagcgggttatcgcttctttgaaatattggag
caattacgtagccgtggaaaagaacgtctagctgctttagaagtatttcattactgcctt
ttattaggttttcagggtaagtaccgaatcgaatctacggaaagtctcaaccatttagta
tcaagagtcggtgacgaaattgactatttgaaagggaaaaaagttgctttttcgccgttc
tcggccattcccgatcagatacgaaatattattcatcgtgaagtacctttcttttggatt
ttgatctttttattgatttttgcattgcttacctttgcagggctaagatttatgctgaat
aatcaaaatgataaagcattatctaattatcaaaatgtgatttctgctcctcaagagcaa
gcacatattacaatttatttaccttga

DBGET integrated database retrieval system