KEGG   Acinetobacter oleivorans: AOLE_17775Help
Entry
AOLE_17775        CDS       T01263                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00010  Glycolysis / Gluconeogenesis
acd00051  Fructose and mannose metabolism
acd00562  Inositol phosphate metabolism
acd01100  Metabolic pathways
acd01110  Biosynthesis of secondary metabolites
acd01120  Microbial metabolism in diverse environments
acd01130  Biosynthesis of antibiotics
acd01200  Carbon metabolism
acd01230  Biosynthesis of amino acids
Module
acd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOLE_17775 (tpiA)
   00051 Fructose and mannose metabolism
    AOLE_17775 (tpiA)
   00562 Inositol phosphate metabolism
    AOLE_17775 (tpiA)
Enzymes [BR:acd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AOLE_17775 (tpiA)
Exosome [BR:acd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AOLE_17775 (tpiA)
  Exosomal proteins of bladder cancer cells
   AOLE_17775 (tpiA)
  Exosomal proteins of melanoma cells
   AOLE_17775 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADI92439
UniProt: D8JHP3
Position
complement(3790400..3791194)
Genome map
AA seq 264 aa AA seqDB search
MSGSTITPWVVGNWKMNPMRANAKQLIEEFKQLLQQNEIADESCHVGVAPVSIALAMVQT
QLQDAAKTVYTVAQDVSRVAGTGAYTGEVSAELLKDSQINFVLVGHSERRDLLGDNVEIL
KAKLQNSLNAGLTVIYCVGESLEQREQDLAEQVVLQQICDIAPVVSAEQWQKQIVIAYEP
IWAIGTGKTASPQDAQAMHAKIREGLSQITSAGPDIAILYGGSVKAENAVELAACPDING
ALVGGASLNAASFYQIVHAFAQSK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggttcgacgattacgccttgggtagttggcaactggaaaatgaacccaatgcgt
gccaatgccaaacaacttatagaagaatttaaacaactattgcaacaaaacgaaattgca
gatgaaagctgccatgtcggagttgctccggtttctattgcacttgcaatggtacaaaca
caattgcaagatgctgcaaaaacagtatatacagttgcacaagatgtatcgcgtgtagca
ggtacaggcgcctatactggtgaagtcagtgcagaattattaaaagatagccaaattaat
tttgtattggtgggtcactctgaacgccgtgatttgttaggtgataacgttgaaattttg
aaggcaaaactccaaaattctttaaatgcaggcttaactgtcatttattgtgtgggtgaa
agtctcgaacaacgtgaacaagatttggcagagcaggttgtattgcaacaaatctgtgat
atagctcctgtagtgagtgcagagcaatggcaaaagcaaattgtaattgcttatgagcca
atctgggcaattggtacaggtaaaactgcttcaccacaagatgcacaggcaatgcatgct
aaaatccgtgaaggtttaagtcagattacttctgcgggtccagacattgcgattttatat
ggcggtagtgtaaaagctgagaatgcagtcgagttggcagcatgtccagatattaatggc
gcgttggttggaggtgcttcgttaaatgcagcatctttttatcaaatcgtacatgccttt
gcacaaagtaaataa

DBGET integrated database retrieval system