KEGG   Acidothermus cellulolyticus: Acel_0175Help
Entry
Acel_0175         CDS       T00426                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00450  Selenocompound metabolism
ace00970  Aminoacyl-tRNA biosynthesis
ace01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ace00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Acel_0175
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Acel_0175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ace01007]
    Acel_0175
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ace03016]
    Acel_0175
Enzymes [BR:ace01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Acel_0175
Amino acid related enzymes [BR:ace01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Acel_0175
Transfer RNA biogenesis [BR:ace03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Acel_0175
 Prokaryotic type
   Other AARSs
    Acel_0175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ABK51950
UniProt: A0LR90
Position
183161..184780
Genome map
AA seq 539 aa AA seqDB search
MTKTFYVTTPIYYVNDAPHIGHAYTTVAADVLARWHRQRGEPVWFLTGTDEHGQKVLRSA
QAGGASPQEWADRLVAEAWQPTWRELDISYDDFIRTTEPRHTGRVQAFLQRLYEKGEIYE
GVYEGPYCVACEEFKLPGELVSGEGEYAGQQVCPVHRRPVDQLSETNYFFRLSKYADALL
DHYAAHPEAVEPESARNEVMQFIRQGLQDLSISRSSFDWGVKIPWDDRQVVYVWFDALLN
YITAIGYDAPDETMRARFASTWPADVHLVGKDILRFHAVIWPAMLLAGGLPLPRKVFAHG
WLLVSGEKMSKTRLTGIAPTQLTAHFGSDAFRYYFLRSFPFGQDASFSWEEMSARYTAEL
ANGLGNLASRVTAMTGRYFDGVLPVPGEVTAAEQRVADVLAAVVPDADAAMDRLDFFTAL
ARIWDLVLVLNGYLTEQQPWQLAKQDDGEARIRLATVLYTAADGLRALAVLLNAVMPRAC
SRLWEQLGAEATLGPLGSQRISDTARFGVLPAGSRLTKRDPLFPRLAEDASGGQAETSS
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagaccttctacgtcaccacgccgatctattacgtcaacgacgcgccgcacatc
gggcacgcctacacgaccgtggccgctgatgttttagcgcgctggcaccggcagcggggc
gagccggtctggttcctcaccggcaccgatgagcacggtcagaaggtgctccgtagtgcg
caggccggcggggcgtccccgcaggaatgggccgatcggctggtcgcggaggcgtggcag
ccgacgtggcgtgagctggatatctcctacgacgatttcatccgcaccaccgagccgcgg
cataccggtcgcgtgcaagcgtttctccagcgcctgtacgaaaagggcgaaatttacgaa
ggcgtctatgaggggccttactgtgttgcgtgcgaggaattcaagctccccggtgaactg
gtgtccggtgagggagaatatgcgggtcagcaggtctgccccgttcaccgtcgtccggtc
gaccagctgagtgaaaccaattacttcttccggttatccaagtacgccgatgcgttgctg
gaccactacgccgcccatccggaagcggtggagccggagagtgcgcgcaacgaggtgatg
cagttcattcggcaggggctgcaggatctgtcgatttcccggtcaagtttcgactggggc
gtcaagattccgtgggacgatcggcaggtcgtctacgtctggtttgacgcgcttttgaat
tacatcacggcgatcggatacgacgctcccgatgagacgatgcgggcgcgcttcgcatcg
acgtggcctgcggacgtccaccttgtcggcaaggatattctgcgctttcacgccgtcatt
tggccggcgatgctgctcgccggcgggctgccccttcctcgcaaagtattcgcgcacggt
tggctcctcgtctccggcgagaagatgagcaagacgcggctgaccggcattgcgccgacg
cagctgacggcgcacttcggctcggacgccttccggtattacttcctccgctcgttcccg
ttcggtcaggacgcctcgttctcctgggaggagatgagcgcccgttacaccgcggaactt
gccaatggattgggtaatctcgcgtcccgcgtcacggcgatgaccgggcggtactttgac
ggcgtgctgcctgttcccggcgaggtgacggcggcggagcagcgggtcgccgatgtgttg
gccgcggtggttcccgacgcggacgccgcgatggaccggcttgactttttcacggccctg
gcgcgcatttgggacctcgttctcgtgctcaatgggtatctcaccgaacagcagccgtgg
cagctcgcgaaacaggacgacggcgaggcacgcatccggctggccacggtgctgtatacc
gcagcggacggcttgcgcgcactcgcggtgcttctcaacgccgtcatgcctcgcgcgtgc
agccggttgtgggagcaactcggtgcggaggcaactcttgggccgctgggcagccaacgc
atctccgacacagcccggttcggcgtcctgccggcaggaagccggctcaccaagcgtgat
ccgctctttccccggctggccgaggacgcctccggggggcaggccgagacatcgtcatga

DBGET integrated database retrieval system