KEGG   Acidothermus cellulolyticus: Acel_0380Help
Entry
Acel_0380         CDS       T00426                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00020  Citrate cycle (TCA cycle)
ace00640  Propanoate metabolism
ace00660  C5-Branched dibasic acid metabolism
ace01100  Metabolic pathways
ace01110  Biosynthesis of secondary metabolites
ace01120  Microbial metabolism in diverse environments
ace01130  Biosynthesis of antibiotics
ace01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ace00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acel_0380
   00640 Propanoate metabolism
    Acel_0380
   00660 C5-Branched dibasic acid metabolism
    Acel_0380
Enzymes [BR:ace01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Acel_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABK52154
UniProt: A0LRU4
Position
393187..394365
Genome map
AA seq 392 aa AA seqDB search
MDLFEYQAKELFAAHGVPITPGEVAENPDQAADIARRLGGRVVVKAQVKTGGRGKAGGVK
LADDADAAAAAAEAILGMEIRGHRVHRVLVTTAVDIAHEYYVAFLVDRSRRSFLAMGSAE
GGVEIEQVAAENPQAIVRVPIDATEGVDATLAARIADDIGFPAAVRDEAVRILRGLWEAF
QAEDASLVEVNPLVRTLDDRLIALDGKVTLDDNADFRHPDRARFADPSAADPLEAKAKAA
GLHYVKLDGEVGVIGNGAGLVMSTLDVVAYAGETYGGIRPANFLDIGGGASAEVMAAGLT
VVLADPAVRAVLVNVFGGITACDAVARGIVAAFENLIAAGERIDVPLVVRLDGNRAAEGR
AILAAAQLPRVEQVETMDDAARRVAELAAAAR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggaccttttcgagtaccaggccaaggagttgttcgcggcgcacggtgttccgattacc
cccggcgaggtcgcggagaacccggatcaggcagcggatattgcccgacgtcttggcggc
cgggtcgtcgtcaaggcgcaggtgaagaccggaggccgggggaaggccggtggggtgaag
ctggccgatgatgccgacgcggcggcagccgcggcggaagcgatcctcggcatggagatc
cgcggtcatcgagttcaccgggtgctggtcacgaccgcggtcgatatcgcccacgagtac
tacgtcgcgtttctcgtcgaccggtcccggcggtccttcctggcgatgggttcggccgaa
ggcggggtggagatcgaacaggtcgccgccgagaatccgcaggccatcgtccgcgttccc
atcgacgccaccgagggagtcgatgcgaccctggccgcccgcatcgccgacgacattggc
tttcccgccgcggtccgcgacgaggcggtgcggatcctccgaggcctgtgggaggccttt
caggccgaggacgccagccttgtcgaggtcaatcccctggtccgcaccctcgacgaccgg
ctgatcgcactcgacggcaaggtgaccctcgacgacaacgccgattttcgccatcccgac
cgagcacggttcgccgacccgagcgccgcggatccactggaagcgaaggcaaaagcagcc
gggctccattacgtgaaattggacggcgaggtcggtgtcatcggcaacggcgccgggctg
gtgatgagcacactcgacgtcgtggcgtacgccggcgaaacgtacggcggaatacgcccg
gcgaatttcctcgacatcggcggcggggcctccgcggaggtgatggccgccggattgacg
gtggtgcttgcggatccagcagtgcgggcggtgttggtgaatgtcttcggcggtattacc
gcgtgcgatgccgtcgcccgtggaattgtcgccgcgtttgagaatctgattgcggctggt
gaacgcatcgacgtcccgttggtcgtccggcttgacggaaaccgggcggccgaagggcga
gcaattctggccgcggcgcaattgccacgcgtcgaacaggtggagaccatggacgatgcc
gcgcggcgggtggccgaactcgccgcggcagcacggtag

KEGG   Acidothermus cellulolyticus: Acel_0381Help
Entry
Acel_0381         CDS       T00426                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) alpha subunit
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00020  Citrate cycle (TCA cycle)
ace00640  Propanoate metabolism
ace00660  C5-Branched dibasic acid metabolism
ace01100  Metabolic pathways
ace01110  Biosynthesis of secondary metabolites
ace01120  Microbial metabolism in diverse environments
ace01130  Biosynthesis of antibiotics
ace01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ace00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acel_0381
   00640 Propanoate metabolism
    Acel_0381
   00660 C5-Branched dibasic acid metabolism
    Acel_0381
Enzymes [BR:ace01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Acel_0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 DapB_N
Motif
Other DBs
NCBI-ProteinID: ABK52155
UniProt: A0LRU5
Position
394382..395269
Genome map
AA seq 295 aa AA seqDB search
MAIFVDRTSRVIVQGITGSEGSKHTQRMLRAGTTIVGGTNPRKAGTFVEFDDVKLPVFAT
VADAMAETGADVAVGFVPPAGAKAAMLEAIDAGIPLLVVITEGIPVHDTMYAWAYAARRG
HRTRIIGPNCPGITSPGQSNVGIIPADITEPGRIGLVSKSGTLTYQMMFELRDIGFSTCV
GIGGDPIIGTTHIDCLRAFQEDPETDVIVMIGEIGGDAEELAAAYIAEHVTKPVVGYVAG
FTAPEGKTMGHAGAIISGSAGTAQAKKEALERVGVRVGRTPSQTAQLVREIMRGR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcgatattcgtagaccgcaccagccgggtcatcgtccaaggcatcaccgggtcggag
gggagcaagcacacccagcggatgctgcgggccggaacgacgatcgtcgggggaacgaac
ccgcggaaggcaggcacctttgtggagttcgacgacgtcaagctgccggttttcgccacc
gtagcggacgcgatggccgaaacaggcgccgacgtcgcggttgggttcgtgccgcccgcc
ggggcgaaggcggcgatgctggaggcaatcgacgcaggaatacctttgctcgtcgtcatt
accgaaggaattccggtccacgacacgatgtacgcctgggcgtatgcggcgcgccgcggg
caccgcacccgcatcatcggaccgaattgcccgggcattacctcacccggccagtcgaac
gtcggcatcattccggccgacatcaccgaacccgggaggatcggcctggtgtcgaaatcc
gggacgctcacctaccagatgatgtttgaattgcgcgacatcggtttttccacctgcgtc
ggcatcggaggggacccgatcatcggcacgacgcacattgattgcctgcgcgcttttcaa
gaggatccggagaccgacgtcatcgtgatgatcggggagatcggcggggacgccgaggag
ctggccgctgcgtacatcgccgaacacgtgacgaaacccgtcgtcgggtatgtcgctggg
ttcaccgcgcccgagggcaaaaccatgggccacgctggagcgatcatctccggctcggcg
ggaaccgcgcaagcgaagaaagaggcgttggagcgggtcggggtccgcgtcggccggacg
ccgtcacagaccgcgcagctcgttcgggaaatcatgcgcggtcgttaa

DBGET integrated database retrieval system