KEGG   Acidothermus cellulolyticus: Acel_0700Help
Entry
Acel_0700         CDS       T00426                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00010  Glycolysis / Gluconeogenesis
ace00020  Citrate cycle (TCA cycle)
ace00620  Pyruvate metabolism
ace00640  Propanoate metabolism
ace00650  Butanoate metabolism
ace00680  Methane metabolism
ace01100  Metabolic pathways
ace01120  Microbial metabolism in diverse environments
ace01130  Biosynthesis of antibiotics
ace01200  Carbon metabolism
Module
ace_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acel_0700
   00020 Citrate cycle (TCA cycle)
    Acel_0700
   00620 Pyruvate metabolism
    Acel_0700
   00640 Propanoate metabolism
    Acel_0700
   00650 Butanoate metabolism
    Acel_0700
  Energy metabolism
   00680 Methane metabolism
    Acel_0700
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Acel_0700
Enzymes [BR:ace01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Acel_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR DUF3763
Motif
Other DBs
NCBI-ProteinID: ABK52473
UniProt: A0LSR3
Position
762970..763554
Genome map
AA seq 194 aa AA seqDB search
MWQIRVHGRGGQGVVTAAELLADAAFRDGYEVQAFPSFGSERMGAPVTAYCRLDTLPIRI
REPVVDADALLVIDASLLRLPETLAGLRTGGWVLVNSARPPQQLGVTSTASSDVHIRWAT
VPATALARRYLGRAVPNAPMLGAFAALTRLVSLTAIEDALSDRFTAPIAEQNIQAARAAF
ASLQQVVTSDAQSA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagattcgggtgcacggtaggggcggacaaggcgtcgtcaccgcggctgagctg
ctcgccgatgcagcctttcgcgacggatacgaggtacaggcttttcccagtttcggttcc
gagcggatgggcgccccggtaacggcgtactgtcgcttggacacactgccgatccgtatc
cgagagcctgtcgttgacgccgatgctcttcttgtcattgacgcatcgttgttgcgtctg
ccggagacgctcgcggggttgaggacgggcgggtgggttctcgtgaattccgctcgacct
ccgcagcagctcggcgtgacatccacggcgtcctccgacgtacacattcgttgggcgacg
gtgccggcgacggcgctggcccgacgctatctgggacgtgcggtgcccaacgcgccaatg
ctcggcgcttttgcagcacttacccgactggtctcgttgacggcaattgaggacgcactg
tcggatcgcttcacggcccctatcgctgagcagaatatccaggcggcccgtgcagccttt
gcttctcttcagcaggtggtgacgagcgatgcgcagtcagcgtga

DBGET integrated database retrieval system