KEGG   Acidothermus cellulolyticus: Acel_0936Help
Entry
Acel_0936         CDS       T00426                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00010  Glycolysis / Gluconeogenesis
ace00020  Citrate cycle (TCA cycle)
ace00260  Glycine, serine and threonine metabolism
ace00280  Valine, leucine and isoleucine degradation
ace00310  Lysine degradation
ace00380  Tryptophan metabolism
ace00620  Pyruvate metabolism
ace00630  Glyoxylate and dicarboxylate metabolism
ace00640  Propanoate metabolism
ace01100  Metabolic pathways
ace01110  Biosynthesis of secondary metabolites
ace01120  Microbial metabolism in diverse environments
ace01130  Biosynthesis of antibiotics
ace01200  Carbon metabolism
Module
ace_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ace00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acel_0936
   00020 Citrate cycle (TCA cycle)
    Acel_0936
   00620 Pyruvate metabolism
    Acel_0936
   00630 Glyoxylate and dicarboxylate metabolism
    Acel_0936
   00640 Propanoate metabolism
    Acel_0936
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acel_0936
   00280 Valine, leucine and isoleucine degradation
    Acel_0936
   00310 Lysine degradation
    Acel_0936
   00380 Tryptophan metabolism
    Acel_0936
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ace04147]
    Acel_0936
Enzymes [BR:ace01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Acel_0936
Exosome [BR:ace04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Acel_0936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_oxidored HI0933_like AlaDh_PNT_C FAD_binding_2 NAD_binding_8 2-Hacid_dh_C FAD_binding_3 3HCDH_N K_oxygenase DAO Trp_halogenase Amino_oxidase Thi4
Motif
Other DBs
NCBI-ProteinID: ABK52709
UniProt: A0LTE9
Position
complement(1032146..1033525)
Genome map
AA seq 459 aa AA seqDB search
MAEQSDVFDLVILGGGSGGYAAALRAAELGMRVALVEKDKVGGTCLHRGCIPTKALLHAA
EIADQAREAATFGVRATFEGIDVDAVHQYKNGVVNRLWRGLQGLIKSRQITYVEGSGRLA
APTAVEVDGRRYEGRHVILATGSQPKSLPGLEIDGERVITSDHALTLDRIPKSVVILGGG
VIGVEFASIWRSFGAEVTIVEMLPHLLPTEDEDSSKLLERAFRRRGITFELGARFEAVKT
TDTGVTVTLAGGKTLEAEYLLVAVGRGPVSAGLGYEEAGVRMDRGFVTVDEYCRTNVPTI
SAVGDLIPTLQLAHVGFAEGILVAERLGNLAPVPIDYDGVPRITYSEPEVASVGLTEAAA
RQKYGEVKTFVYDLAGNGRSQILRTSGAVKVVAVPDGPVVGIHAVGSRVGELIAEAQLIY
NWEALPSEVAQLIHPHPTQSEAIGEAHLALAGKPLHVHG
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaacagtccgacgtattcgacctggtcattctgggcggaggcagcggtgggtac
gcagcggcactgcgcgccgcggagctcggcatgcgtgtcgcactggtcgagaaagacaag
gtaggcggcacgtgtctgcaccgcggatgcattccgacgaaggcgttgttgcacgccgcg
gaaattgccgaccaggcgcgggaagccgcgactttcggtgtgcgggccacattcgaggga
attgacgtcgacgcggtccaccagtacaaaaacggtgtcgtcaaccggctgtggcggggt
ttgcagggcctcatcaagagccgtcagatcacctacgtggagggaagcggtcggctcgcc
gccccgaccgcggttgaggtggacggccggcgttacgagggccggcacgtcatcctggcc
accggctctcagccgaagagcctccctggtttggagattgacggcgaacgcgtcatcacc
agcgaccacgccctcaccctcgaccgcatcccgaaatctgtcgttattctcggcggcggc
gtcatcggtgtcgaattcgccagtatttggcggtcgttcggcgccgaggtcaccatcgtg
gaaatgttgccgcatttgctgccgaccgaagacgaggacagctcaaaacttctggagcgt
gcgttccggcgccgcggcatcactttcgaactcggggcacggtttgaggccgtgaaaacc
acggataccggggtgacggtcaccctcgccggcggaaagacactggaagctgaatacctt
ctggtggcggtcggccgcggaccggtttccgccggcctcggctacgaggaggccggcgtg
cgcatggatcgcggattcgtcaccgtcgacgagtattgccggaccaacgtcccgacgatc
tccgccgtgggtgacctcattcccaccctccagcttgcgcatgtcggtttcgccgaaggg
attctcgtcgcggagcggctggggaatctcgcaccggtgccgatcgactacgacggcgtt
ccccgtatcacgtactccgagcccgaggtcgcatcggtggggctcaccgaggctgcggca
cggcagaaatacggcgaggtcaagacgttcgtctacgatctggccgggaacgggcgcagc
cagatcctgcggacctccggcgccgtcaaagtcgtcgccgtaccggatggacccgtggtc
ggcatccacgcggtcggttcccgggttggtgagctcatcgccgaagcccagctcatttac
aactgggaagcgctgcccagcgaggtcgcccagctcattcatccgcatccgacgcagagc
gaggcgatcggtgaggcgcatcttgcgctggctgggaaaccgttgcatgtgcacgggtga

DBGET integrated database retrieval system