KEGG   Acidothermus cellulolyticus: Acel_0989Help
Entry
Acel_0989         CDS       T00426                                 

Definition
(GenBank) glycine oxidase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00730  Thiamine metabolism
ace01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ace00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Acel_0989
Enzymes [BR:ace01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     Acel_0989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 FAD_binding_2 XdhC_C 3HCDH_N UDPG_MGDP_dh_N Pyr_redox_2 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ABK52762
UniProt: A0LTK2
Position
complement(1088557..1089771)
Genome map
AA seq 404 aa AA seqDB search
MVGAGVIGLATAWRCAQRGFNVTVVDPDPGRGASHYAAGMLAPVTEAHFGEESLLHLTIE
AARRYPAFVADLQAAAGISVGYRTTGMLAVAFDNDDRAVLAELHAYHNSLGLTSTLLSSR
ECRDREPALAPAIRAGLWVEGDHQVDNRRLVQALRAACDRVGVRFLPTEAHLDVHGNRVR
GANGIPAAATVLAAGAWSPHVAGLPEAVRPPVRPVKGQILRLRVDPNRPLLTRAVRAFVR
GRPLYVVPRETGEIVVGGTVEEMGFDQRVTVEAVADLLDDARRLVPGLVDADFVEASAGL
RPGSPDNGPMVGPSGVDGLVIATGHYRNGILLAPITADAVAELLATGAIPEEFVPFDPRR
FFDPDWSARHSHRRTAPAASPRSGKDGTSAEPDAARDEKEAATK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggtgccggagtcatcggattagccaccgcatggcgatgtgcgcagcgtggattc
aacgtcaccgtcgtcgacccggatccgggccgtggcgcgtcgcactacgcggcgggcatg
cttgccccggtgactgaggcgcatttcggcgaagaatctctgctgcacctcacgatcgag
gccgcccgccgttatcccgctttcgttgccgacctgcaggccgcggccgggatatccgtt
ggctaccggaccaccggcatgctcgccgtcgccttcgacaacgacgaccgggcggtactg
gcggagttgcacgcctaccacaactctctcggcctgacgagcaccctgctgtcgtcgcgg
gaatgccgggaccgcgaacctgcgctggcgccggccatccgtgctggactctgggtggaa
ggcgaccatcaggtggacaaccgccggctcgtccaggcactccgcgccgcctgtgaccgg
gtcggagtccggttcctcccgaccgaggcgcaccttgacgtccacggcaaccgggtcagg
ggcgcgaacggcattccggccgccgcgacggtgctcgccgcgggagcatggagtccgcac
gtggccgggcttcccgaggcggtgcgtccaccggtccggcccgtcaagggacagatcctg
cggttgcgggtcgaccccaaccgtccgctgctcacgcgggcggtccgagcctttgtccgc
ggccggccgctgtacgtcgtcccgcgggaaaccggcgagattgtggtcggcggcacggtt
gaggaaatgggttttgaccagcgggtcacggtcgaggcggtcgctgacctgctcgatgac
gcgcggcgtcttgtccccggcctcgtggacgccgacttcgtggaggcctcggctggactc
cgcccaggctcgcccgataacggtcccatggtcgggcccagtggggtggacgggctggtg
atcgcgaccggccactatcgcaacggcatcctgctcgcgccgatcaccgcagacgccgtc
gccgagctgctcgccaccggcgcaatcccggaggagttcgtccccttcgacccacgccgg
ttctttgacccagactggtctgcccggcacagccatcgccgcactgctccggcggcgagt
ccccgcagtgggaaagacggcacgtccgctgagccggatgccgctcgcgacgagaaggaa
gccgcaacaaaatga

DBGET integrated database retrieval system