KEGG   Acidothermus cellulolyticus: Acel_1174Help
Entry
Acel_1174         CDS       T00426                                 

Definition
(GenBank) methionine synthase (B12-dependent)
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00270  Cysteine and methionine metabolism
ace00450  Selenocompound metabolism
ace00670  One carbon pool by folate
ace01100  Metabolic pathways
ace01110  Biosynthesis of secondary metabolites
ace01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ace00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Acel_1174
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Acel_1174
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Acel_1174
Enzymes [BR:ace01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     Acel_1174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans Pterin_bind Met_synt_B12 B12-binding_2 B12-binding CdhD
Motif
Other DBs
NCBI-ProteinID: ABK52946
UniProt: A0LU36
Position
1303820..1307296
Genome map
AA seq 1158 aa AA seqDB search
MTTRAALLRRELARRVLVADGAMGTMLQAARLGPADFTLPDIGVLEGCNEVLSLTRPDVV
AAVHDAYLAAGCDAIETNTFGANLGNLGEYGIADRIEELAAAGARIAREVADRWSTPSEP
RFVLGSVGPGTKLPSLGHVTFAELRDAYQRQVTGLINGGVDAVLVETAQDLLQAKAAVIG
AKRARAAAGVDIPIFASVTVETTGTMLLGSEIGAALTSLEALGIEMIGLNCATGPAEMSE
HVRYLAAHAAVAVSCLPNAGLPILGPDGAQYPLTPGELADALEEYAAQFGLALVGGCCGT
TPEHLRLVAERLRHRPIGSRRAETVPAVSSLYQTVPLRQQTAFLAVGERTNANGSKAFRE
AMLAGRYEDCVELARGAARDGSHLIDVCVDYVGRDGVRDMRELARRLATATTLPVMLDST
EPAVIEAGLECLGGRCIVNSVNFEDGDGPQSRISRLMPIVREHGAAVVALTIDETGQART
AEHKVSVAERLIDTLTNRWGMRETDILVDTLTFTLGTGQEESRRDGIATIEAIREVKTRH
PDVHTILGISNISFGLNPAARAVLNSVFLAECLRAGLDAAIVHPAKILPMSRIPEDQQAV
ALDVIYDRRRPDYDPLVRLMELFAGVTAAASQKSRAAELAAMPLAERLHRRIVDGERNGL
EADLDEALTTRRALDIINEILLPAMKEVGDLFGRGDMQLPFVLQSAEVMKAAVAYLEPHM
EKSNRSGKGTIVLATVKGDVHDIGKNLVDIILSNNGYRVVNLGIKQPITAILEAAERHDA
DAIGMSGLLVKSTVVMRENLQEISSRGLAKRWPVLLGGAALTRAYVEDDLASEFDGTVRY
AKDAFEGLRLMDTLMAIKRGEPGASLPPLRRRRIAQSATAVSEPASRSDVATDIPIPTPP
FLGDRVVKGIPLGDYLGYLDEKALFAGRWGLRSRPNGPSYAEIVEAEGRPRLRQWLDRLQ
AENLLAAGVVYGYYRCVSEGDDLIILADDGRTERCRFRFPRQQRGRRLCIADFFRPAGSG
ETDVVAFQLVTIGARVSAFTARLFADGAFRDYLEVHGLSVQLAEALAEFWHRRIREELGI
ADADHPELREILDHQGYRGSRYSFGYPACPDLEDRAKIVQLLKPERIGVRLSEEYQLDPE
QSTDALIVHHPEAKYFSV
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccgcgccgccctgctccgccgtgaactggctcgacgcgtcctcgtcgcggac
ggcgcaatgggcaccatgctgcaagccgcccggcttgggccggccgatttcaccctgccg
gatatcggcgtcctcgagggatgcaacgaagtcctcagcctcacccgtcccgacgtcgtt
gccgccgtccatgacgcctacctggccgccggctgtgacgccatcgaaaccaacaccttc
ggggcgaacctgggaaacctcggcgagtacgggatcgccgaccggatcgaggagcttgcc
gccgccggggcgcggatcgcccgggaggtcgccgaccgatggtccacgccgtccgagccg
cggttcgtcctcggctcggtgggtccgggaacgaagctgccgagcctggggcacgtgacg
ttcgccgagctccgcgacgcttaccagcggcaggtcaccgggctgatcaacggtggggtc
gacgcggtcctcgtggaaacagcacaggatctcttgcaggcgaaggcggccgtcatcggc
gcgaagcgggccagagctgctgcgggtgtcgacattccgatcttcgcctcggtgacggtc
gagaccaccgggacaatgctgctcggctccgagatcggtgctgcgctgaccagcctcgag
gcgctcggcatcgaaatgatcggattgaattgcgcgaccggtccggcggagatgagcgaa
cacgtgcggtacctcgccgcgcacgccgccgtcgccgtgtcgtgcctgcccaatgccgga
ttgccgattctcggcccggacggcgcacagtatccgctgacccccggcgagcttgccgac
gccctggaggagtacgcggcgcagttcgggctcgctctcgtcggcggatgttgcggaacc
accccggagcacctgcggctcgttgccgagcggctccgccaccggccgatcggttcgcgg
cgggccgagaccgtgcctgccgtctcctcgctgtatcagacggtgccgctccgccagcag
accgctttccttgccgtgggggagcggaccaacgccaacgggtcaaaggcgtttcgggag
gccatgctcgccggacggtacgaggattgcgtcgaactggcccgcggggcggcccgggac
gggtcgcacctcatcgacgtctgcgtggactacgtgggccgggacggcgtccgcgacatg
cgggaactcgcccgccggttggccaccgcgaccaccctgccggtcatgctcgactcgacg
gaacccgcggtcatcgaagcgggattggaatgcctgggcgggcggtgcatcgtcaattcg
gtgaatttcgaggacggtgacgggccgcaatcgcgaatatcccgcctcatgccgatcgtc
cgcgaacatggggccgccgtcgtcgccctcacgatcgatgaaaccgggcaggcccggacg
gccgagcacaaagtctccgtcgccgaacggctcattgacacgctgaccaaccgctggggg
atgagggagacggatattctcgtcgacacgttgacgttcaccctgggcaccggtcaggag
gagagccgacgcgacgggatcgccaccatcgaggcgattcgcgaggtgaaaacccgtcat
ccggacgtgcacacgattctcgggatctcgaacatctcttttggcctgaacccggcggct
cgcgccgtcttgaattcggttttcctcgctgagtgcctccgcgcggggctggacgccgct
attgtgcacccggcgaaaatcctgccgatgtcgcggattcccgaggaccagcaggccgtc
gccctggatgtgatttacgatcgacgccggccggattacgatccgctcgtccggttgatg
gaactgttcgccggggtgacggcggcagcgtcgcagaagtcccgagccgcggagcttgcg
gcaatgccccttgcggagcggttacatcgacggattgtggacggcgaacgcaacgggttg
gaggcggacctcgacgaggcgttgacgacccggcgggccctcgacatcatcaacgagatt
ctcctgccggcgatgaaggaggtcggtgacctttttggccggggcgacatgcaattgccc
ttcgtcctgcaatccgcggaggtcatgaaagccgcggtcgcctacctcgaaccgcacatg
gagaagagcaatcgatccgggaaagggacgatcgtcctcgcgaccgtcaagggcgacgta
cacgacatcggcaagaatctcgtcgacatcatcttgtccaacaacggctaccgcgtggtg
aatctcggcatcaaacagccgatcaccgcgatcctcgaggctgcggaacggcatgatgcc
gacgcgatcggcatgtccgggctgctcgtgaaatccaccgttgtcatgcgggagaacctg
caggaaatctcttcccggggactcgcgaaacgatggcccgtcctgctcggcggtgccgcg
ctcacccgcgcgtacgtcgaagacgacctcgcatcggagttcgacggcacggtccggtac
gccaaggacgccttcgaaggcttgcggctgatggacaccctgatggccatcaagcggggc
gagccgggcgcgagcctgccgccgttgcggcgccgccgcattgcacaatcggcaaccgcg
gtgtccgagccggcgtcccgttccgacgtcgccaccgacatcccgatacccacgccgcct
ttcctcggtgaccgcgtcgtaaagggaattccgctcggcgattatctcggctacctcgac
gaaaaggcactcttcgccggccggtgggggttgcgcagccgtccgaacgggccgagttat
gcggaaatcgtggaagccgaggggcgcccccgcctacggcagtggcttgaccgcctgcag
gccgagaatctgctggccgccggcgttgtctacggctactatcgctgcgtctccgagggt
gacgacctcatcattctcgccgacgacggccggaccgagcggtgccgtttccggttcccg
cgccagcaacgcgggcggcggctgtgcatcgcggatttcttccggccggccggcagcggg
gagaccgacgtcgtcgcttttcagctcgtgacaataggcgcgagggtcagtgcgttcacc
gcacggttgttcgcggacggcgctttccgtgactatctggaggtccatggactgtccgtc
cagctggcggaagcgctggcggaattctggcatcggcgcatccgggaggagctgggcatt
gcggatgcggaccacccggagctgcgggaaatcctcgaccaccagggataccgtggatcg
cggtactccttcggctatccggcgtgccccgatttggaagaccgcgcgaaaatcgttcaa
ctgctcaagccggagcgtatcggcgtacggctctcggaggagtatcaactcgacccggag
cagtcgacggatgcactgatcgtccatcacccggaagcaaagtacttctcggtgtga

KEGG   Acidothermus cellulolyticus: Acel_1723Help
Entry
Acel_1723         CDS       T00426                                 

Definition
(GenBank) methionine synthase (B12-independent)
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00270  Cysteine and methionine metabolism
ace00450  Selenocompound metabolism
ace01100  Metabolic pathways
ace01110  Biosynthesis of secondary metabolites
ace01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ace00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Acel_1723
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Acel_1723
Enzymes [BR:ace01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     Acel_1723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Meth_synt_2 Meth_synt_1
Motif
Other DBs
NCBI-ProteinID: ABK53495
UniProt: A0LVN5
Position
1939464..1941818
Genome map
AA seq 784 aa AA seqDB search
MTTTRSSSNRPQGPRSRSTVYGYPRQGPGRQLKKLTEAYWAGRLDADAFLAQTRELRRAR
WIELRDAGIDEIPSNDFSYYDHVLDTAVMLGALPRRHAPALADAGQSPAARLDRYFALAR
GNDDAAPLEMTKWFTTNYHYLVPELRPDMEFRLDPTKPLSEFREARELGLTTRPVILGPV
SFLLLSKREPGVPGDFQPLSLLGKIICPYLELIRRLFDAGAEWVQFDEPCLVADQPAQVL
DAVATAYATLCAEEFRPRLLVATYFDRLGDALPVLADSPVDGIAMDITGPARANIDDLAA
IGGIPTKRLVAGVVDGRNVWRTDLAAALSTLGTLLGLAGQVDVSASCSLLHVPLSIEFER
QLDPQIAGWLAFARQKLEEIVILTRGLNDGWEAVAGDLQVSAARRATRLASPIVQVDAVR
RRAAEAAGLPRTRRSPYAERRIVQRRQLGLPALPTTTIGSFPQTPALRAARAKLRAGELD
AAGYEALIEAEIAAVIAEQEAAGLDVLVHGEPERNDMVQYFAEQLDGFLTTAEGWVQSYG
TRYVRPPIVVGDVARRGPMTVRWATYAAGRTQKPVKGMLTGPVTMLAWSFVRDDLPRAEV
ARQVALALRDEVLDLEAAGLRVIQIDEPALRESLPLRNADRAEYLSWAVDAFRLVTSGVR
DETQIHTHMCYAEFGDILQALIDMDADVISLEAARSDMAIVTDLARAGYPNDIGPGVWDV
HSPRIPTVQEIVDRIHLALKECPADRLWINPDCGLKTRGYAEVRPALANMVAAARAVRAE
LGLV
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacaacacgttcgtcgtccaaccgcccacaggggccgcgcagccgctccaccgtc
tacggttatccgcggcaagggcccgggcggcagctcaagaaactgaccgaggcgtactgg
gccggacgcctggacgctgacgcgttcctggcgcagacccgtgaattgcgccgcgcgcgg
tggatcgaactgcgggacgcgggcatcgacgagatcccgagcaacgatttctcgtactac
gaccatgtgctggacaccgctgtgatgctgggcgcactgccgcggcggcacgcacccgcc
ctggcggacgccggccagtcccccgccgcgcgcctggaccggtatttcgccctggcccgc
ggcaacgacgacgccgctccgctggagatgacgaaatggttcaccaccaattaccactac
ctggttcccgaactccggccggacatggaattccgactggatccgacgaagcccttgagt
gaattccgggaggcgagggagcttggcctcacgacacggcccgtgattctcggcccggtc
agttttctgttgctctccaaacgggagcccggcgtcccgggcgatttccaaccgctctcc
ctcctcgggaaaatcatctgcccctacctggaattgatccgccgcctcttcgacgccggg
gcggagtgggtgcaattcgacgagccctgccttgtcgccgaccagcccgcgcaggtgttg
gacgcagtcgccactgcgtacgcaaccctgtgcgcggaggaatttcggccgcgactcctc
gtcgcgacgtattttgaccggctcggtgacgccctccccgttcttgccgattcgcccgtc
gacgggatcgccatggacatcaccggtccggcgcgcgcaaatatcgatgatttagcggcg
atcggcggcatccccacgaagcggctcgtcgccggtgtcgtcgacggccgcaatgtctgg
cgcaccgacctcgctgcggcgctgtccacgctcggcaccctgctcgggctggcggggcag
gttgatgtgtcagcgtcgtgctccttgctgcacgttccgttgagtatcgaattcgagcgg
cagttggatccgcagatcgccggttggctggcgttcgcccggcagaaactcgaggaaatt
gtcattctcacccgcgggctcaacgacggctgggaagcggtcgccggcgacctgcaggtc
agtgcggcgcggcgggcgacccggctggcgtcgcctatcgtgcaggtcgatgcggtccgg
cgccgggcggccgaagcggcaggtcttccgcggacccggcgcagcccgtacgccgaacgg
cggatcgtgcagcgccgtcagctcggtcttccggctcttcccaccacgacaatcggatcc
ttcccgcagacgccggcattgcgggccgcccgggcgaaactccgggccggcgaattggat
gccgcgggttacgaggctcttatcgaggcggaaatcgcggctgtcatcgccgaacaagag
gcggccgggcttgacgtgctggtccacggcgagccggaacggaacgacatggtgcagtac
ttcgccgagcaactcgacggttttctcaccaccgcggaaggatgggttcagtcgtacggc
acccgctacgtccggccgcctatcgtggtcggggatgtcgcgcgccgcgggccgatgacg
gtccggtgggcgacgtacgccgcgggccgtacgcaaaaaccggtcaagggcatgctgacc
ggcccggtgacgatgcttgcctggtcgttcgtccgcgacgaccttccccgggcggaggtg
gcgcgacaagtcgctcttgcgctgcgcgatgaggtgctggatttggaggcggccgggtta
cgggtcattcaaatcgacgaaccggcgctgcgcgaatcgttgccgctgcggaatgcagat
cgcgccgaatacctgagctgggcggtcgacgcctttcggctcgtcacctccggcgtccgc
gacgaaacacaaattcacacccacatgtgttacgcggaattcggcgacattctgcaggcg
ctcatcgacatggacgccgacgtcatcagcctggaggccgcccgctcggatatggcgatt
gtcacggatctggcccgcgccgggtatccgaacgacatcggaccaggagtgtgggacgtg
cattcgccgcgcattcccaccgtgcaggaaatcgtcgaccgcattcacttggcgctgaag
gagtgtcccgctgatcggctctggatcaatccggactgcgggttgaagacccgcggctac
gccgaggtgcgccctgcactggcgaacatggtcgccgctgcgcgcgccgtccgggctgag
ctcggtttggtctga

DBGET integrated database retrieval system