KEGG   Acidothermus cellulolyticus: Acel_1425Help
Entry
Acel_1425         CDS       T00426                                 

Definition
(GenBank) Cys/Met metabolism pyridoxal-phosphate-dependent enzyme
  KO
K01758  cystathionine gamma-lyase [EC:4.4.1.1]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00260  Glycine, serine and threonine metabolism
ace00270  Cysteine and methionine metabolism
ace00450  Selenocompound metabolism
ace01100  Metabolic pathways
ace01110  Biosynthesis of secondary metabolites
ace01130  Biosynthesis of antibiotics
ace01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ace00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acel_1425
   00270 Cysteine and methionine metabolism
    Acel_1425
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Acel_1425
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ace04147]
    Acel_1425
Enzymes [BR:ace01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     Acel_1425
Exosome [BR:ace04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acel_1425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Prot_ATP_ID_OB Met_gamma_lyase
Motif
Other DBs
NCBI-ProteinID: ABK53197
UniProt: A0LUT7
Position
complement(1591296..1592498)
Genome map
AA seq 400 aa AA seqDB search
MNDAGTPRHPEQSDPRCQSAEPADTGRSGATPIVSGDGTRVLTAGGMPGGQGTPLVPSPV
FASTYVLHGEPAGPYQYGRLTNPTWTAWEAALADLEGGPAIAFASGIAAVTAVLATTLRP
GDTMLMASDCYYATRRLAEEFLSDFGVVTRWAPTGPEMAAQVAGARLVWIESPSNPGLDV
CDIAELARRCRDEGALLAVDNTTATPLGQQPLLLGADFSVASDTKAMTGHSDIVLGHVAC
RTGELAERIRGWRNSTGAIPGPFETWLAHRSLATLDLRLARQADNARELAAMLAAHPAVR
RVRYPWLPSDPAYPLAVRQMRRPGGLVSFELAGAAEAEAFLGALRLVTVATSFGGVHSTA
ERRARWGGDDVPPGFIRFSCGCEDAADLLADVEQALARLR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgctgggacgccgcggcatccggagcagagcgatcctcgctgccaatccgcg
gaacccgccgataccggccgatccggcgccaccccgatcgtctccggtgacggcacccgc
gttctcaccgccggcggaatgcccggcgggcaaggcactccgctggtaccgagtccggtt
ttcgcctccacgtacgtgctgcatggagagcccgccggcccttatcagtacggtcggctg
acgaatccgacctggacggcgtgggaggcggcgctcgccgatctcgaaggcggtccggcg
atcgcttttgcctccggaatcgccgcggtcaccgccgtcctcgccacgacactacgaccc
ggggacaccatgctgatggcgtccgattgctattacgcaacacgtcgtctcgcggaggaa
tttctcagcgatttcggggttgtgacccgctgggctccgaccgggccggagatggccgcg
caggtcgcgggtgcccggctggtgtggatcgaatcaccgagcaatccagggctcgacgtc
tgcgatatcgccgagcttgcgcgccgatgccgcgacgaaggcgctctgctcgccgtcgac
aatacgacagccactccactcggccagcagccacttctgcttggtgcggatttctctgtt
gcgagtgacaccaaggcgatgaccggccacagcgacatcgtgctgggacacgttgcttgc
cgcaccggcgagctcgccgagcggatccgcggctggcgcaacagcaccggggcgattccc
ggaccgttcgagacctggctcgcgcatcgatccttggccaccctggatctgcggctggct
cggcaggctgacaacgcccgcgaactggccgcaatgctcgccgcgcaccccgccgtccga
cgggtgcgctatccgtggctgccgtcggatccggcgtacccgctcgccgtgcgccagatg
cgtcgtccgggcgggctggtctcgttcgagctcgccggcgctgccgaggccgaagcattt
ctcggcgcgctgcgcctcgtcaccgtcgcgacgagtttcggcggcgttcactccacggcg
gagcggcgggcgcggtggggcggcgacgacgtcccacccggcttcatccggttcagctgc
ggctgcgaggacgcagcggatttactcgccgacgtcgagcaggcgctcgctcgtctgcgg
tag

DBGET integrated database retrieval system