KEGG   Acidothermus cellulolyticus: Acel_1536Help
Entry
Acel_1536         CDS       T00426                                 

Definition
(GenBank) 23S rRNA m(2)A-2503 methyltransferase
  KO
K06941  23S rRNA (adenine2503-C2)-methyltransferase [EC:2.1.1.192]
Organism
ace  Acidothermus cellulolyticus
Brite
KEGG Orthology (KO) [BR:ace00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ace03009]
    Acel_1536
Enzymes [BR:ace01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.192  23S rRNA (adenine2503-C2)-methyltransferase
     Acel_1536
Ribosome biogenesis [BR:ace03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    Acel_1536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_14
Motif
Other DBs
NCBI-ProteinID: ABK53308
UniProt: A0LV48
Position
complement(1733250..1734542)
Genome map
AA seq 430 aa AA seqDB search
MPAGRAVSGRLENDMTTHAMTDAARAGAVTRRGVPRHLADFSLAERRRWVAELGEPSFRA
VQISAHYFGRLTENPDEMTDLPASSRRELVGVLLPPLLRPVRELACDNGLTRKILWRLSD
GAYVESVLMRYPPRHSRHAALGAEADADGGSRHGRVTLCVSSQAGCGMGCPFCATGQAGL
VRNLSAAEIVAQVAVAARTVARGEMAGGPGRLSNVVFMGMGEPLANYRSVVDAVRRITEP
PPEGLGISQRSVTVSTVGLVPAIERLATEGLAVTLAVSLHAPDDELRNVLVPINRRWPVR
DVLGAAARYAEVTKRRVSVEYALIRDVNDQPWRADALAAQVKEFLGRLGHVNLIPLNPTP
GSPWTASTPRAQAEFVRRLAAAGVTVTVRDTRGREVNGACGQLAATVEFRGRTVQETPAP
SMAALDDAVR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgccggccgggcggtctctggcagactcgagaacgatatgacgacgcacgcgatg
accgatgctgctcgggcgggagcggtgacacggcgcggcgtcccacgccatctggcggat
ttttcgttagcggaacggcgccggtgggtggccgaactcggcgagccgtccttccgggcc
gtgcagatctccgcccattacttcggtcgtctcacggagaatccggatgagatgaccgac
ctgcccgcctcgtcgcgccgggagctggtcggcgtcctgcttccgccgcttctgcggccg
gttcgggagctcgcgtgcgacaacgggctcacccggaagatcctctggcggctcagtgac
ggtgcgtacgtcgaatccgtcctcatgcgttatccgccccggcacagccgccacgctgcg
ctcggggctgaagcggacgcggacggcggttcgcggcacggccgggtcacactgtgcgtg
tccagtcaggcgggctgcggcatgggatgcccgttctgcgccaccggccaggccggtctg
gtccggaacctgtccgccgcggagattgtcgctcaggtcgcggtcgccgcccgcacggtg
gcgcgcggggaaatggccggcggcccagggcgattgtccaacgtggttttcatgggcatg
ggggaaccgttggcgaattaccggtcggtggtggacgccgtgcgaaggatcaccgagccg
ccgccggaaggtctcggcatttcccagcgcagtgtcaccgtctcgaccgtgggcctggtt
ccggccatcgagcggctcgcgacggaaggactcgcggtcacgctcgcggtctcgttgcac
gcgccggacgacgagctgcgcaacgtccttgttccgattaatcgacgctggccggttcgt
gacgttctcggtgccgccgcgcggtacgccgaggtgacaaagcggcgggtgtccgtcgaa
tacgcgttgattcgcgacgtcaacgaccagccgtggcgtgcggatgcgttggctgcgcag
gtcaaggaattcctcggccgtcttggacacgtcaatctcatcccgctcaatcccacgccc
ggctccccgtggacggcgtccacaccgcgggcgcaggcggaattcgtccggcgcctggcg
gctgcgggggtgaccgtgaccgtccgggatacccgcgggcgggaggtcaacggcgcgtgc
ggtcagcttgccgctacggtggaatttcgcggccgcaccgtccaggagacgcctgcgccg
tcaatggctgcgcttgatgatgccgtccgctaa

DBGET integrated database retrieval system