KEGG   Acidothermus cellulolyticus: Acel_1583Help
Entry
Acel_1583         CDS       T00426                                 

Definition
(GenBank) phosphomethylpyrimidine kinase
  KO
K00941  hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC:2.7.1.49 2.7.4.7]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00730  Thiamine metabolism
ace01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ace00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Acel_1583
Enzymes [BR:ace01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     Acel_1583
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphooxymethylpyrimidine kinase
     Acel_1583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phos_pyr_kin PfkB HK Carb_kinase
Motif
Other DBs
NCBI-ProteinID: ABK53355
UniProt: A0LV95
Position
complement(1782548..1783342)
Genome map
AA seq 264 aa AA seqDB search
MAARPRVLAIAGSDPSAGAGLQADLKTMFACGVYGMTVVTAVTAQNSRGVSAVWPVPPEA
VAAQLDAVLGDIGVDAVKIGMLARADTVHVVADRLAALDVPIIVDPVGFASHGEPLADTD
ARAVLRSRLLPLATLVTPNLAEAAELAGVTVHEETDLELAAWAMKTLGPEWVLVKGGHLA
GDAVDALYDGVTVRFFRSPRIATAHTHGTGCTLASAIASYLARGYSVPDAVGRAKDAVTA
AIAGGFPLGSGTGPVDHDRLLDFR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaagaccgcgggttctcgcgatcgcggggtctgacccatcggccggcgcgggt
ctgcaggccgacctgaaaacgatgttcgcgtgcggggtgtacggcatgacggtcgtgacg
gcggtgacggcacagaattcccgtggcgtctccgccgtgtggccggtaccccccgaggcg
gtcgcggcacagctcgacgctgtcctgggggacattggggtggacgccgtgaaaatcggc
atgttggcacgcgcagacaccgtgcacgtggttgctgatcggcttgccgcactcgacgtt
ccgatcatcgtcgatccggtggggttcgccagccacggtgaaccgctggccgacaccgac
gcgcgggctgtgttgcggagccggctgctgccactcgccacgctggtcacgccgaacctt
gccgaagcggccgaactcgcgggcgtcacggtgcacgaggaaacagacctcgaactcgcg
gcgtgggcgatgaagacccttgggccggagtgggtgctcgtcaagggcggccatctggcg
ggcgacgcagtcgatgcgctgtacgacggtgtcaccgtccggtttttccggagtccccgc
atcgcgaccgcgcacacccacgggaccgggtgcaccctcgccagcgccatcgcgagttac
cttgcccggggctactcggtgcctgacgcggtcggacgggcgaaggacgccgtcaccgcg
gcgatcgccgggggcttcccgctgggctcgggtaccgggccggtcgaccacgatcgattg
ctggattttcggtag

DBGET integrated database retrieval system