KEGG   Acidothermus cellulolyticus: Acel_1617Help
Entry
Acel_1617         CDS       T00426                                 

Definition
(GenBank) sulfate adenylyltransferase subunit 1
  KO
K00956  sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00230  Purine metabolism
ace00261  Monobactam biosynthesis
ace00450  Selenocompound metabolism
ace00920  Sulfur metabolism
ace01100  Metabolic pathways
ace01110  Biosynthesis of secondary metabolites
ace01120  Microbial metabolism in diverse environments
ace01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ace00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Acel_1617
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Acel_1617
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Acel_1617
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Acel_1617
Enzymes [BR:ace01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     Acel_1617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU MMR_HSR1 GTP_EFTU_D2 FeoB_N
Motif
Other DBs
NCBI-ProteinID: ABK53389
UniProt: A0LVC9
Position
complement(1820457..1821752)
Genome map
AA seq 431 aa AA seqDB search
MLHTDTPPVSTLDRTVGMLRFATAGSVDDGKSTLVGRLLHDSKAVLADTLESVRRASRSR
GSDDIELALITDGLRAEREQGITIDVAYRYFTTPRRKFVLADTPGHVQYTRNMVTGASTA
ELVVLLVDARKGVVEQTRRHLAVAALLGIRHLVLAVNKMDLVGFNESVFRGIAADFASAA
EALGISDHTVIPVSALRGDNVVEKSAEMPWYTGPTLLEHLETVDVDLDQAGQPVRFPVQY
VIRASEYRGYAGQLASGILRVDDDVVVLPVGLRSRVAAIDTFDGPLTEAAAPRSITVRLY
DELDIGRGDLLVTPGAEPTVTREFAATICQLAERPLRVGDRLLVKHTTRVVKGVIDAITY
RLDIATLRKEKADGELVLNDIGGVRLRVAAPLAVDDYATDRLTGAFLLIDEQDGATLAAG
LVGDPLESRTG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgttgcatacggatactccacccgtgtccacgctcgaccgcactgtcggcatgctgcgg
ttcgccaccgcggggagtgttgacgacggaaaatccacccttgtcggccggttgctccac
gactccaaagcggtgctcgccgacacacttgaatccgtgcggcgcgccagccgcagccgg
ggttcggacgacatcgaactcgccctgatcaccgacggtttgcgggccgagcgggaacag
ggcatcaccattgacgtggcctaccggtacttcacgacaccgcgccgcaaattcgtcctc
gccgacacgcccggccacgtgcagtacacgaggaacatggtgaccggcgcatccactgcg
gaactggtcgttctgcttgttgacgcgcgcaaaggcgtcgtcgagcagacccgccgacac
ctcgcggtcgccgcgctcctcggcattcggcacctggtgcttgcggtgaacaaaatggac
cttgtcggctttaatgagtccgttttccgcggcatagcggcggatttcgcgtcggcggct
gaagcgctcggcatcagcgaccataccgtgatcccggtcagcgcattgcgcggcgacaac
gtggtggagaagtcggctgagatgccctggtataccggtccgacacttctcgagcatctc
gaaaccgtcgacgtcgatctcgaccaggctggccagcccgtccgatttcccgtgcagtac
gtcatccgcgcctcggaatatcgcgggtatgccggccaattggcaagcggcatcctccgg
gttgacgacgacgtcgtcgtcctcccggtcgggctgcgcagccgtgtcgccgctatcgac
acgttcgacggtccgctcaccgaagcggcggccccacgctccattaccgtgcggctctac
gacgagcttgatatcggacgcggtgacctgctcgtgacgccgggtgccgaaccgacggtg
acgcgcgaattcgccgcaacaatttgtcagcttgcggagcggccgctgcgggtcggtgac
cgtctcctcgtcaaacacaccacccgcgtcgtcaaaggggtcattgacgccatcacgtac
cggctcgacattgcgacgcttcgcaaggagaaagcggacggcgaattggtgctcaacgac
attggcggagtgcggttgcgcgtcgcagcgccgcttgccgtggatgattacgccacggac
cggctcaccggcgcatttctcctcatcgatgagcaggacggcgcgacgcttgccgccgga
cttgtcggcgatcccctcgaatcgcgtaccggttag

KEGG   Acidothermus cellulolyticus: Acel_1618Help
Entry
Acel_1618         CDS       T00426                                 

Definition
(GenBank) sulfate adenylyltransferase subunit 2
  KO
K00957  sulfate adenylyltransferase subunit 2 [EC:2.7.7.4]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00230  Purine metabolism
ace00261  Monobactam biosynthesis
ace00450  Selenocompound metabolism
ace00920  Sulfur metabolism
ace01100  Metabolic pathways
ace01110  Biosynthesis of secondary metabolites
ace01120  Microbial metabolism in diverse environments
ace01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ace00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Acel_1618
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Acel_1618
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Acel_1618
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Acel_1618
Enzymes [BR:ace01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     Acel_1618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAPS_reduct QueC ATP_bind_3 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: ABK53390
UniProt: A0LVD0
Position
complement(1821756..1822742)
Genome map
AA seq 328 aa AA seqDB search
MSVRSEIAAGPTYRADPVSVRRTAADRQPRRPVVPHLDLLESESIHIIREVAAEFERPVL
LFSGGKDSAVMLHLALKAFWPAAIPFPVMHVDTGHNFPEVLDFRDRLVARLGLELIVVSV
QDYIDAGKLRERPDGTRNPLQTVPLLDAIAAHRFDAVLGGGRRDEEKARAKERIFSLRDD
FGQWDPRRQRPELWNLYNGRHRPGEHVRVFPLSNWTELDVWEYIERENIELPSIYFAHER
EVFLRNGMWLAPGAWGGPRDGEVVERKKVRYRTVGDMSCTGAIESTASTVAEVIAEVAAS
RITERGATRADDKLSEAAMEDRKREGYF
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgcgtagtgagatagccgcaggtccgacgtaccgtgcagatccggtgtcagtc
cggcgcacggcagccgaccggcaaccgcgccgtcccgtcgtgccgcacctggatctcttg
gaatccgagagcattcacatcattcgggaggtggccgccgaatttgagcgtcctgtgctg
ctgttctccggcgggaaggacagcgcggtgatgcttcacctcgcgctgaaagccttctgg
ccggcggccattcccttcccggtcatgcacgtggacaccggacacaatttcccggaagtc
ctcgactttcgcgatcgcctggtcgcgcggctcggccttgagctcatcgtcgtgagcgtt
caagactacattgacgccggcaagctgcgggaacggccggacggaacgcgaaacccgctg
cagaccgtgccgctgctcgacgctattgccgcccaccggttcgacgccgtcctcggcggc
ggtcgccgcgacgaagaaaaagcgcgggccaaggagcgaattttctcgctgcgggacgac
ttcgggcaatgggatccccgtcgccagcgtccggagctgtggaatttgtacaacggccgg
catcgccccggcgagcacgtccgcgttttcccgctatccaactggaccgaactggatgtc
tgggagtacatcgagcgggagaacattgagctgccctccatttacttcgcgcacgagcgc
gaggtcttccttcgcaacggcatgtggctcgcgcccggtgcgtggggcgggccgcgcgac
ggcgaggtggtggagcggaagaaggttcgctaccgcacggtcggtgacatgagctgcacc
ggggcgatcgagtcaaccgccagtacggtcgccgaggtcatcgcggaggtggcggcgagc
cggatcaccgagcggggcgcgacccgggcggacgacaagctctccgaggcggcgatggaa
gaccggaaacgggaaggttacttctag

DBGET integrated database retrieval system