KEGG   Acidothermus cellulolyticus: Acel_1681Help
Entry
Acel_1681         CDS       T00426                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00030  Pentose phosphate pathway
ace01100  Metabolic pathways
ace01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ace00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Acel_1681
Enzymes [BR:ace01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     Acel_1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_zinc_N ADH_zinc_N_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABK53453
UniProt: A0LVJ3
Position
complement(1892490..1893542)
Genome map
AA seq 350 aa AA seqDB search
MSVRALSVVPGKPETAQVGDHPDPPESDGSVLVDGLLIGICGTDVEILREGYGWAPPGEE
RLVIGHESLGRVAAAPPDSGFSPGDLVAGIVRRPDPVPCVPCSLGAWDFCRNGRYTERGI
KERHGYAANQWRIEPEFAVRLDPTLGDLGVLLEPTSVVAKAWDQAEKVAARSPAPRHVAL
VTGAGPIGLLAALLGVQRAYQVHVFDQVTTGPKPDLVADLGATYHTGDIAGIGVQPDVVI
ECTGHGPLVFALTDVVATDGVICLTGISASKRQAAMRPDEVNKEMVLDNLALVGSVNASR
AHYEAAAAALAAADRSWLARLITRRVPLERFDQALERQDGDVKVVLELAH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtacgcgcgttgtccgtcgtcccaggaaaacctgagacggcgcaggtcggcgac
cacccggacccacctgaatcggacgggtccgtgctcgtcgacggtctgctgatcgggatc
tgcggcacggacgtcgaaatccttcgggaaggctacggctgggccccgcccggggaggaa
cgcctcgtcatcggccatgaatcgctcggccgggtggcggccgcgccgccggacagcggg
ttctcccccggggatcttgtcgcgggtatcgtccggcgcccagacccggtgccgtgcgtg
ccgtgcagtttgggcgcatgggatttctgccggaacggtcggtacaccgaacgcgggatc
aaggaacgacacgggtacgcggcgaaccagtggcggattgagccggagttcgccgtccgc
cttgaccccaccctcggtgacctcggcgtgctcctcgaaccgacgtcggttgtcgccaaa
gcctgggaccaagcggagaaagtcgccgcccggtccccggcgccacggcacgtcgcgttg
gtgaccggcgccggaccgatcggattgctcgccgcgctgctcggcgtccaacgcgcctac
caggtgcacgtcttcgaccaggtcaccaccggaccgaaaccagacctcgtggccgatctc
ggggccacgtatcacaccggtgatatcgccggcatcggggtccagccggacgtcgtcatt
gaatgcaccgggcacggaccgcttgtcttcgccctcaccgacgtggttgcgaccgacggc
gtcatttgcctcaccggaatttcggcgtcgaagcggcaggcggcgatgcgtccagacgag
gtgaacaaggaaatggtcttggacaacctcgcgctcgtcgggagtgtcaatgcgtcccgg
gcgcactacgaggcggccgccgctgcgctcgccgcggcggaccggtcgtggctggcccgg
ttgatcacccgccgggttccgctggagcgtttcgaccaagcgttggaacggcaggacggc
gacgtgaaggtggtgctcgaactcgcgcactga

DBGET integrated database retrieval system