KEGG   Acidothermus cellulolyticus: Acel_2027Help
Entry
Acel_2027         CDS       T00426                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ace  Acidothermus cellulolyticus
Brite
KEGG Orthology (KO) [BR:ace00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Acel_2027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABK53799
UniProt: A0LWI9
Position
complement(2300347..2301348)
Genome map
AA seq 333 aa AA seqDB search
MTTAAIILIVVVALAFDFTNGFHDAANAIATSISTRALTPRVALGMSAILNLIGAAVSTR
VAGTVGKGIVAAPQGSRGLALVFAAVIGAIAWNLLTWYFGLPSSSSHALIGGLVGAAVVT
KAGFNAVHWSGVIDKVVIPMVISPLVGVAAAFVLMLVILWVFQRAKPGPMNKGFRYLQTL
SAAAMSYSHGTQDAQKTMGVITLALVTGGYIHSFRVPAWVIFSAAAAMAAGTYAGGWRII
RTLGRRIIQLDPPRGFAAEATSSAVLLTAAHFGAPVSTTHVITSAVMGAGATRRISAVRW
GVAANIVLAWIFTIPGAAVTAALVHLAVMPIAG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggccgcaatcatcctcatcgtcgtggtcgccttggcatttgatttcaccaac
ggctttcatgacgccgccaacgcgatcgcgacgtcaatctccacccgggcgctgacgccg
cgagtcgcccttggcatgtcggcgatcctgaatttgatcggagctgcggtgtcaacccgg
gtcgcgggtaccgtcggtaagggcatcgtcgctgctccccagggcagccgcggtcttgcg
ctcgtgttcgcagcggtcatcggtgccatcgcgtggaatctcctcacctggtacttcggc
ctgccgtcgtcctcgtcacacgcgctcatcggcgggctggtaggtgccgccgtcgtcacg
aaggcggggttcaacgccgtccactggtcaggggtcatcgacaaagtcgtgattccgatg
gtgatttcaccattggtcggcgtggcggcggcatttgttctgatgctcgtcattctgtgg
gtttttcaacgcgccaagcccggtccgatgaacaagggcttccggtatttgcagacgttg
tccgcggcggccatgtcctattcacacggcacccaggatgcgcagaagactatgggtgtc
atcacgctggcgctggtgaccggaggctacattcacagtttccgcgtaccggcgtgggtc
atcttctcagccgcagccgcgatggcggccggcacgtacgccggggggtggcgcatcatc
cgaacgctcgggcgccggatcatccagctcgacccgccccggggtttcgccgctgaagcg
acctcatctgctgtccttcttacggcggcacatttcggcgcgccggtctcgacgacgcac
gtcatcacctccgcagttatgggggcgggtgcgacgcggcggatatcggccgtccgttgg
ggtgtcgcggccaacattgtgttggcgtggattttcaccattcccggtgccgcggtgacc
gccgcgctggttcatctcgcggtgatgccgatcgccggctga

DBGET integrated database retrieval system