KEGG   Atta cephalotes (leaf cutting ant): 105617820Help
Entry
105617820         CDS       T04923                                 

Definition
(RefSeq) annexin B9-like isoform X1
  KO
K17095  annexin A7/11
Organism
acep  Atta cephalotes (leaf cutting ant)
Brite
KEGG Orthology (KO) [BR:acep00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acep04147]
    105617820
Exosome [BR:acep04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105617820
  Exosomal proteins of other body fluids (saliva and urine)
   105617820
  Exosomal proteins of colorectal cancer cells
   105617820
  Exosomal proteins of bladder cancer cells
   105617820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin DrrA_P4M
Motif
Other DBs
NCBI-GeneID: 105617820
NCBI-ProteinID: XP_012054762
UniProt: A0A158NB54
Position
Unknown
AA seq 323 aa AA seqDB search
MAASQYYHIQCTPTVYPADPFDAEEDANLLRSAMKGFGTDEQAVLDVLAHRGIVQRLEIA
DKFKTMYGKDLISELKSELSGNFEKAILALMTPLPEYYAKELHDAISGMGTDEGALIEVL
ASLSNYGIKTISAVYKDLYDKELEDDLKSDTSGYFKRLLVSLSCASRDESPNVDEEAARQ
DAERLQAAGEGQWGTDESTFNAILITKSFPQLRRIFKEYEHLTGDTLKHAIKREFSGSVE
DGYLAVVKCASDKTAYFAERLYKAMRGMGTDDSTLIRIIVTRSEIDLGDIKDAYERLYGK
SLAEAIDDDCSGDYKRLLLALVG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcagctagtcagtattatcacatacagtgcacacccaccgtgtatccggctgatcct
tttgatgccgaagaagatgccaatctattacgatctgcaatgaaggggttcgggactgat
gagcaggccgtattagacgtcttggctcatcgcggtatcgtacagcgactagaaattgcc
gacaaatttaagacaatgtacggcaaggacctcatttccgagttgaagtcagagttatcc
ggaaactttgagaaagccatcctggctctaatgacgcctcttcccgagtattacgccaag
gagttgcatgatgctatttccggcatgggcaccgacgaaggtgcactcatcgaagttctt
gcatccctgagcaattatggaatcaagacgatatccgctgtttacaaggacctgtacgac
aaagagctggaagatgacctcaaaagtgatacctccggttatttcaagaggcttttggta
tcattgtcttgcgctagtagagacgagagtccaaacgttgatgaggaggccgcgcgtcag
gatgccgagaggcttcaagccgcaggtgaggggcagtggggcactgatgaaagcactttc
aatgcaattctcattactaagagttttccacaattgcgacggatcttcaaagaatacgag
cacctcaccggagataccttgaagcatgctatcaagcgagaattctctggttctgtcgaa
gatggctacttagctgtggtgaaatgcgcctctgataagactgcttatttcgcggaaaga
ttgtacaaagctatgcgcggaatgggcacggacgattcgacattgatacgcatcattgtg
acacgatcagagattgatctgggcgatattaaggatgcctatgagagactttatggaaaa
tctcttgcggaagctatcgacgacgactgttcaggcgactacaagagacttttgcttgcc
cttgtcggatga

DBGET integrated database retrieval system