KEGG   Atta cephalotes (leaf cutting ant): 105618552Help
Entry
105618552         CDS       T04923                                 

Definition
(RefSeq) endoplasmic reticulum resident protein 44
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
acep  Atta cephalotes (leaf cutting ant)
Brite
KEGG Orthology (KO) [BR:acep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acep04131]
    105618552
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acep04147]
    105618552
Membrane trafficking [BR:acep04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    105618552
Exosome [BR:acep04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105618552
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin OST3_OST6 Thioredoxin_2 HyaE
Motif
Other DBs
NCBI-GeneID: 105618552
NCBI-ProteinID: XP_012055474
UniProt: A0A158ND66
Position
Unknown
AA seq 428 aa AA seqDB search
MLFHCDIFHFKVLTFACLLIRLPNNIAEEVKEGALSLTSKNIDETLADNELVFINFYAQW
CRFSNLLAPIFDEAADKVKEEFPQSGKVVMAKVDCDRETSVASRFHITKYPTLKVIRNGQ
PTKREYRGQRSVEAFQEFVRKQLEDPIKEFSDLRELEQLDDKKRMIIGYFERKDVPEYEL
FRKVATNLKDDCQFYVGFGTCSNQNCEIGQHLHLLNASKAMHPPGEPIIAFRSDKALSVE
MDETYKGSLSVYDELNVWAQEKCVPFVREITFENAEELTEEGLPFLILFHAPDDLQSVKQ
YKYIVTKSLLSEKQNINFLTADGLKFAHPLHHLGKSTADLPLIAIDSFRHMYLFNDFNDI
FVEGKLKAFLQDLYSGKLHREFHYGPDITNNEIPVTGKQVKTPTTPPESAFKKLAPSKNR
YTIVKDEL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgctgttccactgtgatatatttcacttcaaagtacttacgttcgcgtgtctgctgata
cgtttgccaaacaatatagcagaggaagtaaaagaaggtgccctttcactcacaagtaaa
aatattgacgaaaccttagctgataatgaactggtctttatcaacttttatgcacaatgg
tgtcgtttcagtaacttattagcaccaatatttgatgaagctgcagataaggttaaagaa
gaatttccacagtctggaaaagtagtaatggccaaagtggattgtgatcgcgaaacctct
gtggcatctaggtttcatataaccaaatatccaacgttaaaagtaataagaaacggtcaa
ccaactaagagagaatacagaggacaacgatcagtagaagcattccaagaatttgtcaga
aagcagttggaagatcccattaaagaattttccgacttgagagagcttgaacagcttgac
gataaaaaacgtatgattataggatactttgaacgaaaagatgtaccagaatatgaattg
ttcagaaaagttgccactaatttgaaggatgattgccaattttatgttggttttggcaca
tgttccaatcaaaactgtgaaattggtcagcatttacatttgctgaatgcaagtaaagca
atgcatcctcctggagaacctatcattgccttccgatcagacaaagctctatctgttgaa
atggatgaaacttacaagggaagtttatcagtttatgacgaattaaatgtatgggcgcag
gagaagtgtgtgccatttgtaagagaaataacatttgaaaatgctgaagaactaacagag
gaaggcttgccattccttatattgttccatgctcctgatgacttacaaagcgtcaagcaa
tacaaatatatcgtaactaaatcattattaagcgaaaaacagaatataaatttcttaacc
gctgacggcctgaaatttgcgcatccattgcaccatttggggaaaagcacagcagatttg
ccactgattgcaatagatagctttagacacatgtacctattcaatgatttcaatgacatt
tttgtagaaggaaaacttaaagcttttctacaggacttgtattctggaaagcttcatcgc
gagtttcactacggtcctgatattactaataatgaaataccagttactggaaaacaagta
aaaacgcctacaacgcctccagaatccgcgtttaaaaaactggcgccaagtaaaaatagg
tatacaatagttaaggatgaactgtaa

DBGET integrated database retrieval system