KEGG   Atta cephalotes (leaf cutting ant): 105618737Help
Entry
105618737         CDS       T04923                                 

Definition
(RefSeq) bone morphogenetic protein receptor type-2
  KO
K04671  bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:acep00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    105618737
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acep01001]
    105618737
Enzymes [BR:acep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     105618737
Protein kinases [BR:acep01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   105618737
Cytokine receptors [BR:acep04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   105618737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Activin_recp Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 105618737
NCBI-ProteinID: XP_012055659
UniProt: A0A158NDQ1
Position
Unknown
AA seq 956 aa AA seqDB search
MRAIVSIVLITLLCGISLAPINARKCASRKKNVENLSLKQNSAGVSEVTSNDHNINEDVK
FEICNNFCHALWQEDKTANGTEIIILSQGCWKQSGEQKCENTECVALQRSTKALNNTKFC
CCHGDLCNLNITSSNLADPDNKIFNPLSSQKSQPTTEYLEQSNYERLLLIIVTGVACTSL
VICTISMIIYKSSHNNILIRLGKSLSYNDQFMDSTALRTGTYTVDHLKLANIVGQGRYGS
VWQGSMGDQDVAVKIYPSHYRNYFQNERDTYCLPFMEHPSLLSYYGVDERISMEGSIEYL
LVLSFAPGGSLTEFLRTHIIDWNTFCKMSLSIVKGLAYLHTDIRKGDKFKPCIAHRDINS
RNILIKADGSCYICDLGLAVQISGSKYYSNGEEQHAELKSINDVGTLRYMAPEVLDGAVN
LRDCESSLKQIDVYAMGLVLWELITRCSDIYIPGSDVPQYKQPYENEIGLHPTFEQMQVL
VSRNKARPLLEGNLVDRPGVRLIKETIEDCWDADAEARLTALCIEERLSELQSHRVTMHF
TDGSPMVNSHCTLVPSTTNSLYSESSHHDNVHVVQLALNTVQDSNTNDSAIAENLVTLSP
SDSVAHEHSFKNSNEIATYNHTQTLQPYQGRNPCMERNLMLQSDSLEDLSCNGNVLVDKS
LKHACNDQYKTGTEVQGLVSHDYLSQHTTQLTQLRPATPIPYVQNVISDEGSSSYGKRKQ
TNIQDTSLQESPRKKLFAWPNLKKLLINKKMYPYSRYQIDREDSKSNLLSKQNVQIKTVE
TNVTISPGGKYVNGIIGKTSTSAMPVEKNDKNIAQTGKQKQYENDNATSNARPSTLPLVN
LRNKKRENNLSRQESIDKFNEVFNVGSNVNNALKDPHMRIKTPGDLPPSVRKVRGRAQST
ARFSLYDDRMMCNILNEEDDQSDKAIWNSVPFGMDLGDSDGKHSPTKLGTKNVTCF
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgagagccattgtatcaatcgtgctgatcacactgctgtgtggcataagcttagctcct
attaatgccaggaaatgtgccagtagaaagaaaaatgttgaaaatctttctttgaaacag
aattcagcaggtgtatctgaagttacatccaatgatcataatataaatgaagatgtcaaa
tttgagatatgtaataatttctgtcatgccttatggcaagaggataaaacggcaaatggc
actgaaataattattttatctcaaggttgttggaaacagtctggtgaacaaaaatgcgaa
aatacagaatgtgttgcacttcagagatctacaaaagctttgaataacacgaagttttgt
tgctgtcacggagatttatgtaatctcaatattacaagctccaatcttgcagatccggac
aacaaaatatttaatcctctttcgtcgcaaaagagtcagccaactacagaatatcttgaa
cagtcaaactatgaacgattgttgcttattatagtaaccggtgtagcatgtacatcgcta
gtaatatgtactatatccatgattatatacaaatcctctcataacaatattttaataaga
ttaggaaagtcattatcttacaatgatcagttcatggatagcacagcattaagaactggt
acttacactgttgatcatttgaaactcgcaaatattgtaggccaaggacgatacggatca
gtttggcagggcagtatgggagaccaagatgttgcagttaaaatatatccatcacattat
cgcaattattttcagaatgaaagagacacttattgtctaccttttatggaacatccatca
ttattaagctattatggtgtggatgaaagaataagcatggaaggtagtattgaatatctt
ttagtactcagttttgctccgggtggtagtttaacagaatttttacgaactcacattatt
gattggaacacattctgcaaaatgagtctttccattgttaaaggacttgcttatttacat
acggatatacgcaaaggtgacaagtttaagccatgcattgcacatagggatataaattca
agaaacatattaattaaagctgatggttcttgctatatttgtgatttgggattagcagtt
caaatctctggatcgaaatattattctaatggagaggagcagcatgccgaattaaaatca
attaatgatgtgggcactctgagatacatggcgccagaagtgttggatggtgctgttaat
ttacgggattgcgaaagttctttaaaacaaatagatgtttatgcaatgggtttagttctt
tgggaactgattacaagatgttctgacatttatattcctggatcggatgtaccgcaatat
aaacaaccatatgaaaatgaaataggtcttcatccaacgtttgaacaaatgcaagtctta
gtatcacgtaataaagcaagaccacttttagaaggtaacttagtagatagaccgggagtg
cgtttgattaaggaaactatagaagattgttgggatgctgatgctgaagctcgtttaact
gctttgtgtatagaagaacgactttcagaactgcaatctcatcgtgtaacgatgcacttt
actgatggaagtccaatggtgaattctcactgcaccttagtgccttcaacgacaaacagt
ctttatagtgagtcctcgcatcatgacaatgtacatgttgttcaacttgcattgaacacg
gtgcaagatagtaatactaacgacagtgcaatagctgaaaacttagttacattatcacca
tctgacagcgttgctcatgaacacagtttcaaaaattcaaacgaaatagcgacatataat
catactcaaacgcttcagccgtatcagggcagaaatccgtgtatggaaagaaatttaatg
ttacaatcagattcgttggaagacttaagctgtaacggtaacgttctcgtcgataaatca
ctgaagcatgcgtgtaatgatcaatacaaaactggaacagaagtacaaggcttagtttcg
cacgattatttaagtcaacatactactcaattaacacaacttaggccggcaacgcctata
ccatatgttcaaaatgttatttctgatgaaggatcatcttcttatggtaagagaaagcag
acaaatatacaggacacgtctcttcaagaaagcccacggaaaaaattatttgcctggccc
aatttaaaaaaattgctcatcaataagaaaatgtatccatatagcagataccaaatagat
agagaagattctaagtcaaatttattatcaaagcaaaatgtccagattaaaactgtagaa
acgaacgtaacaatttcgcctggaggaaagtatgtaaatggtattattggtaagacttct
acttcggcgatgccagtagagaagaatgataaaaatatcgcacaaacggggaagcaaaaa
caatatgagaatgataatgcgacgtctaacgcgcgtccttccactttgcctctcgtaaat
ttaagaaataaaaaacgagaaaataatctaagcaggcaagaaagcatagataaatttaat
gaagtttttaatgtaggttcgaatgtaaacaacgcactgaaggatccacatatgagaata
aaaacacccggtgatttgccgccgtctgttaggaaagttcgcggtcgagcgcaatcaacg
gcgcgattttcgctttatgatgatcgcatgatgtgcaatattttgaatgaagaggacgat
caaagtgacaaagccatttggaattctgtgccatttggtatggatctcggtgatagtgat
ggaaaacattcaccaacgaaacttggtaccaaaaatgttacgtgcttttaa

DBGET integrated database retrieval system