KEGG   Atta cephalotes (leaf cutting ant): 105619085Help
Entry
105619085         CDS       T04923                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00450  Selenocompound metabolism
acep00970  Aminoacyl-tRNA biosynthesis
acep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acep00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    105619085
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    105619085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acep01007]
    105619085
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acep03016]
    105619085
Enzymes [BR:acep01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     105619085
Amino acid related enzymes [BR:acep01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   105619085
Transfer RNA biogenesis [BR:acep03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    105619085
 Prokaryotic type
   Other AARSs
    105619085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS GST_N_5 tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-GeneID: 105619085
NCBI-ProteinID: XP_012056005
UniProt: A0A158NEP7
Position
Unknown
AA seq 973 aa AA seqDB search
MIVSTNEGNPNALKLVIATKLAQETVSVRILKPSDATLGRLPTLTISTGLSLFSVSSALR
FLLSVPKELEVLNDRWLEWEISQLQPAILSHASVKTSKTLQKSNLWSLLKDLNSDLRDKQ
YLIEKCSNLSPADISIWVSLWSTILVTDIINDIAKDLPSVNSWLANIQKQPIIQQSIKES
IEMFKLERGPKAIASIESASWFPINTASNSQVHESVPSDISPIKEKEMDIVNQEELRNMA
KSWTTEQYLEVKESSYPILPKKGERNILITSALPYVNNVPHLGNIIGCVLSADIFARYCR
QRNYNTLYICGTDEYGTATEAKALQEKTTPQAICDKFFDIHNDVYRWFGIGFDYFGRTST
PEQTEIVQAFFLKIKSQGYVLTETVEQLHCESCDRFLADRFVEGMCPGCKYEDARGDQCD
GCGHLVNAVELINPRCKICNTKPVVKNSVQFFLDLPKLEEKLKEYSTTHDKGWSNVARVV
SKAWLRDGLQPRCITRDLKWGIPVPVEGFENKVFYVWFDAPFGYISITKRYTKEYKQWWQ
PPSQDIKIDLYQFMAKDNIPFHTIMFPACLLAANQNYTLMKCILATEYLNYEDKKFSKSR
GIGVFGTDARDTGIPADVWRFYLAYIRPETQDSNFNWVDLATKNNSELLNNLGNFVNRAL
AFSEKFFDSNIPPIEPEETDWTVLALAQRELSAYINAMEQGKLKDGLKRILAISKHGNQY
MQFQQPWVKIKGNDDDKKKAGTVVAICCNLACLLSALLAPFMPNTAKQLRSQLGLSNKNY
GYIPETITNMLPTWHKIGKPSPLFTKIEDQKVEMLRKKYAGQQETNGDGMNKSSESIALL
EAAIIKQGNLVRELKAKNDKGVWQPQVEILLDLKKKLTDLKSNANAPAKKSPAKNKKAEP
MHMPEQNGDALTDVATLESAIAKQGNLVRELKAKEDGSVWKPQVEILLKLKQRLSDLTGT
TPVIVDKKSKKKK
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atgattgtttccacgaatgagggtaacccgaacgcgctgaagttggttattgcaactaaa
ttagcgcaggaaaccgtctccgttaggattctgaagcctagtgatgctaccctgggccgt
ttgccgacgctgactatatccacaggattatctctattcagtgtctcgtcagcattgcgc
ttcctgttatctgtacctaaagaattagaggttctcaatgacagatggttggaatgggaa
atttctcaattacagccagccatattaagtcacgcgagtgttaaaacttctaaaactcta
cagaaatccaatttatggtctttactaaaagatctcaatagtgatctgagagacaaacag
tacttaattgagaaatgtagtaatttatcaccagcagatatttctatttgggtaagtctt
tggagcaccatattggttacagatatcataaatgatattgctaaggacttaccaagtgtc
aatagttggttagctaatattcaaaaacagccaattattcaacaatcaattaaggaatct
attgaaatgttcaaattagagagaggtccaaaggctattgcaagtattgaatctgcttct
tggtttcctatcaatacagcctcaaattctcaagttcatgaatcagtacctagtgatatt
agcccaattaaagaaaaagagatggatattgttaatcaagaagaacttcgtaatatggca
aagagctggaccactgaacaatatctagaagtcaaggaaagttcatatcctatactgcct
aaaaaaggtgaacgaaatatcttgataacatcagctcttccatatgttaataatgtcccg
catttaggaaatattatcggctgcgttctttcagctgatatctttgcaaggtattgcagg
caaagaaattacaatactctttacatatgtggaaccgatgagtatggcactgcgactgaa
gcaaaagctctgcaagaaaaaacgactcctcaagctatttgtgataaattctttgatata
cacaatgatgtttaccgctggtttggcatcggattcgactatttcggccgcactagtaca
cctgaacagacagaaatcgttcaagcgtttttcctaaaaattaaatcgcaaggctacgtg
ttgaccgagactgtggaacaattacattgcgaatcttgtgatcggtttctcgctgataga
tttgtggaaggcatgtgtcctggatgtaagtacgaagacgcacgcggcgaccaatgcgat
ggttgtggtcatctcgtcaacgcagtcgagttaataaaccctcgatgtaagatctgtaac
actaaacctgttgtgaaaaactcagtacaattcttcttggatttacccaagttagaagaa
aaactgaaggaatattccactacacatgataaaggatggtccaacgtcgcgagagtagtt
tcaaaagcatggttacgcgatggtcttcagcctcgttgcataaccagagatttgaagtgg
ggaatacctgtcccggtagagggtttcgaaaataaagtgttttacgtctggtttgacgct
cctttcggatatatcagtattacaaagaggtatactaaagaatataagcaatggtggcaa
cctccttctcaggatataaaaatcgatttgtaccaatttatggcaaaggataacattcca
ttccacacgataatgtttcccgcttgtttattagcggctaatcaaaattatacgttgatg
aaatgtatactggcaactgaatatttaaattatgaggataagaaattctccaagtctaga
ggtatcggagtattcggaaccgatgccagagataccggaattccagctgatgtatggcga
ttttatttagcttacattagacccgaaactcaagattccaattttaattgggtggattta
gccacgaaaaataatagcgaattactaaataatcttggcaattttgtcaacagagctcta
gcattctctgaaaaattcttcgactctaatataccaccgatagagccggaagagaccgat
tggactgtattagcattggcacaacgtgaactgtcggcttatataaatgccatggagcaa
ggcaaattaaaagatggcttaaaacgcatattggcgatttcgaagcacggcaatcaatat
atgcaattccagcaaccatgggtgaaaatcaaaggaaatgacgacgacaagaaaaaagcc
ggaactgttgttgcaatttgctgtaatttagcctgtcttctttccgctcttttggctccc
tttatgcccaatacagccaaacaattgagatctcaactaggtttgagtaacaaaaattat
ggttatatccccgaaacaataacaaacatgttacctacttggcacaaaatcggcaagccc
agtccgttgttcactaagatcgaagatcaaaaagttgaaatgttacgcaagaaatatgct
ggacagcaagagactaatggcgatggaatgaacaaaagttccgaaagtatcgcattatta
gaagccgctatcataaagcaaggcaacttagtaagagaattgaaagctaaaaacgataag
ggcgtttggcaaccgcaggtagaaattttattagatttaaaaaaaaagctaaccgatctc
aaaagtaatgcgaatgcgcctgcgaaaaaatcacctgcgaaaaataagaaggccgaaccg
atgcatatgcccgaacaaaatggggatgctctaacagacgtagcgacattagagtcagcg
atcgcgaagcagggcaatctcgtacgagaattgaaggccaaggaagatggaagtgtatgg
aagccacaagtggaaatattattgaaattgaaacaacgtttgtcagatcttactggaaca
acaccagtcattgttgacaagaaatctaagaaaaaaaaataa

DBGET integrated database retrieval system