KEGG   Atta cephalotes (leaf cutting ant): 105619924Help
Entry
105619924         CDS       T04923                                 

Definition
(RefSeq) stress-activated protein kinase JNK
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep04013  MAPK signaling pathway - fly
acep04068  FoxO signaling pathway
acep04137  Mitophagy - animal
acep04140  Autophagy - animal
acep04141  Protein processing in endoplasmic reticulum
acep04214  Apoptosis - fly
acep04215  Apoptosis - multiple species
acep04310  Wnt signaling pathway
acep04391  Hippo signaling pathway - fly
acep04624  Toll and Imd signaling pathway
acep04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:acep00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105619924
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105619924
   04310 Wnt signaling pathway
    105619924
   04391 Hippo signaling pathway - fly
    105619924
   04068 FoxO signaling pathway
    105619924
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105619924
   04137 Mitophagy - animal
    105619924
  09143 Cell growth and death
   04214 Apoptosis - fly
    105619924
   04215 Apoptosis - multiple species
    105619924
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    105619924
  09158 Development and regeneration
   04361 Axon regeneration
    105619924
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105619924
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acep01001]
    105619924
Enzymes [BR:acep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105619924
Protein kinases [BR:acep01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105619924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH RIO1 Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 105619924
NCBI-ProteinID: XP_012056829
UniProt: A0A158NH21
Position
Unknown
AA seq 389 aa AA seqDB search
MPYLGPDMTTRLSAMFYTVEVGDTKFTILKRYQNLKPIGSGAQGIVCAAYDTVTAQNVAI
KKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRSLDEFQDVYLVMELMDAN
LCQVIQMDLDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLAR
TAGTTFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIRGGVLFPGTDHIDQW
NKIIEQLGTPAQEFMQRLQPTVRNYVENRPRYPGYPFERLFPDVLFPSDSSEHNRLKASQ
ARDLLSRMLVIDPERRISVDEALLHNYINVWYDEGEVNAPAPGPYDHSVDEREHTVDQWK
ELIYQEVMEYETSHNPAAVAQSSESAGSR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgccttacctggggcctgacatgacaacccggctatccgccatgttttacacggttgag
gtcggggacaccaagtttaccatcctgaagcgctaccaaaacctcaagcctatcggatcg
ggcgcgcaggggatagtctgcgcggcgtacgataccgtcactgcgcaaaatgtggcgatc
aagaagctatccagaccttttcaaaacgtgacacacgcgaagagggcctacagagagttc
aaactcatgaagttggtcaatcacaaaaacataatcggtctcctgaacgcgtttacaccg
caacgatcgctggatgagtttcaagacgtgtatctggtgatggagctcatggacgctaat
ctatgccaagtgatccagatggatctggaccacgagcgtatgtcgtatctcctctaccag
atgctgtgcggcatcaagcacttgcactccgccggcattattcacagggatctgaagcca
agcaatattgtcgtaaaatctgactgtacgctaaagattcttgactttggcttggcgagg
accgccggtaccacatttatgatgacgccctacgtcgtcacacgatattatcgggcgccg
gaggtgattctgggcatgggttacaaagagaatgtggacatctggtcggtggggtgcatc
atgggcgagatgatacgcggtggtgtattatttccgggcacggatcatattgaccagtgg
aataaaataatcgaacaacttggtacaccggcgcaggaattcatgcaacgattgcagccg
accgtcagaaattacgtagagaataggccacgatatccaggctatcccttcgagaggcta
tttccagatgttctattcccctcggactcctcagaacacaatagattaaaagcgagccaa
gccagggatctattatcgcgcatgctcgtgatcgatccggagcgacgcatttccgtggac
gaggcgttgctgcacaattacataaacgtctggtacgacgagggggaagtcaatgctcct
gcgccaggtccatatgatcatagcgtggacgagagggaacatacggtggatcagtggaag
gagctgatttatcaggaggtgatggaatacgaaacaagccacaatcccgcggcggttgct
cagtcatcagaaagcgctgggagtcggtag

DBGET integrated database retrieval system