KEGG   Atta cephalotes (leaf cutting ant): 105620558Help
Entry
105620558         CDS       T04923                                 

Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha isoform X1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
acep  Atta cephalotes (leaf cutting ant)
Brite
KEGG Orthology (KO) [BR:acep00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acep04147]
    105620558
Enzymes [BR:acep01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     105620558
Exosome [BR:acep04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105620558
  Exosomal proteins of other body fluids (saliva and urine)
   105620558
  Exosomal proteins of colorectal cancer cells
   105620558
  Exosomal proteins of bladder cancer cells
   105620558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 Cation_efflux HAD Sigma70_r4
Motif
Other DBs
NCBI-GeneID: 105620558
NCBI-ProteinID: XP_012057439
UniProt: A0A158NIT1
Position
Unknown
AA seq 1035 aa AA seqDB search
MDDKHGRSDSYRVATLPNIRDDNKTADGMYKSRRKNPKRRGDNLDDLKQELDIDFHKVSP
EELYQRFQSHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFALLLWIGA
ILCFIAYSIQASTSEDPNDDNLYLGIVLAAVVIVTGIFSYYQESKSSKIMESFKNMVPQF
ATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARGFKVDNSSLTGESEPQSRS
PEFTNENPLETKNLAFFSTNAVEGTAKGVVICCGDQTVMGRIAGLASGLDTGETPIAKEI
HHFIHLITGVAVFLGVTFFIIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTA
KRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIDADTTEDQSG
LQYDRTSPGFKALAKIATLCNRAEFKPGQDGEPILKREVNGDASEAALLKCMELALGDVM
GIRKRNKKVCEIPFNSTNKYQVSIHESDDPNDPRHLLVMKGAPERILDRCSTIFIGGKEK
VLDEEMKEAFNNAYLELGGLGERVLGFCDYTLPSDKFPVGFKFNADDPNFPVDGLRFVGL
MSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRL
NIPVSEVNPREAKAAVIHGTELRELNSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRM
GAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLI
FDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVPAISLAYEEAE
SDIMKRQPRNPFTDKLVNERLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPLYLFGIRK
QWDSKAINDLTDSYGQEWTYRDRKTLEFTCHTAFFVSIVIVQWADLIVCKTRRNSIIHQG
MRNWALNFGLVFETALAAFLSYTPGMDKGLRMFPLKFVWWLPALPFMFAIFIYDETRRFY
LRRNPGGWLEQETYY
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atggatgacaagcatggccgctcagattcgtacagggtcgccacgttacccaacattcgt
gacgacaacaaaaccgcagacgggatgtacaagtcgcggcggaagaatccaaagcggagg
ggggacaatctagatgacctgaagcaagagttggacattgacttccataaagtctcaccc
gaggaactgtatcaaagatttcagtcgcaccccgaaaacggcctcagccacgcgaaagcg
aaggagaacctggaaagagacgggccgaacgccctgacgccgccgaagcagactccggaa
tgggtaaagttctgcaagaacttgttcggcggttttgccctcctactgtggatcggtgcg
attctctgcttcatcgcgtactcgatccaggcctcgaccagcgaggacccgaacgacgac
aatctctacctgggtatcgtcctcgcggcggtcgtaatagtcacgggtatattctcgtac
taccaggagagcaagtcaagcaagattatggagtcgttcaagaatatggtgccgcaattc
gccaccgtaatccgggagggtgagaaacttaccctacgggcggaggatctcgtgttgggc
gacgtcgtcgaggttaaattcggcgaccggataccggccgacatcaggattattgaggcc
cgtggatttaaggtggacaacagctcgctgacgggcgaatccgaaccgcaatcgagatcg
cccgagttcacgaatgagaacccgctcgaaacgaaaaatctcgcgttcttctcgacgaat
gcggtagaaggcacggccaaaggcgtggtgatctgttgcggcgatcagacggtgatggga
aggatcgcaggtctcgcgtccggcttagataccggtgagacaccgatcgccaaagagatt
catcactttatacacctcattaccggtgtcgctgtcttcctcggcgtcacattctttatc
atagccttcattctgggttatcactggcttgacgccgtcatcttcctaatcggtattatt
gtggcgaacgtaccggagggtcttctcgctactgtgaccgtgtgcctcactctgaccgcc
aagcgaatggcctcgaagaactgcctggtgaagaatctcgaggctgtggaaactttgggc
tcgacttcgaccatctgctcggacaaaactggaaccctcacgcaaaatcgtatgacggtg
gcgcacatgtggttcgacaatcagattatcgatgccgataccacagaagatcagtctggc
ttgcaatatgaccgcactagtccgggatttaaggcgttggcgaagattgcgaccctatgc
aatcgtgccgagtttaagccgggccaggatggtgaaccgattctgaagcgagaagttaac
ggtgacgcttctgaggctgcattgctcaagtgtatggaattggcattaggcgatgtcatg
ggcattaggaaacgcaacaagaaagtctgcgagattcccttcaattctactaataaatat
caggtatccatacacgaatcagacgatcccaacgatcctagacatctcttggtgatgaag
ggtgctcctgagagaatattggacaggtgctcgaccatatttattggtggcaaagaaaag
gttctcgacgaagaaatgaaggaagcgttcaataacgcgtacttggaattgggcggactc
ggtgaacgagtgctcggcttctgtgattatacactgccgtccgacaagttcccggttggc
ttcaaattcaatgccgacgaccccaatttcccagtcgacggactccgcttcgtaggcctg
atgtctatgattgatccgcctcgggccgcggtgcccgacgcagtcgccaagtgccgttcc
gccggcatcaaggtcatcatggttaccggtgaccatccgatcactgccaaagccattgcc
aaatccgtcggcatcatctctgaaggtaatgaaaccgtcgaggacattgcgcaacgatta
aatatcccggtatccgaagtaaatcctcgcgaggctaaagccgcggtcattcacggaact
gaactcagggaactgaactccgaccaattggacgagattctcaggtaccacaccgaaatt
gtgttcgcccgtacctcgcctcagcaaaagctcatcatcgtcgaaggctgccagcgaatg
ggtgcgattgtcgctgtaactggcgacggtgtgaacgattcgcctgctctgaaaaaagcc
gacattggtgtcgctatgggcatcgctggttcggacgtctccaagcaagcagccgatatg
attttactggatgacaactttgcttcgattgtaacaggcgtggaagagggtcgtttgatc
tttgacaacctaaagaaatccatcgcctacaccctgacctcgaatatacccgaaatttcg
cctttcttggcattcattctctgcgatatccctttgccgttgggtaccgtcaccattctt
tgcatcgatttaggaactgacatggtacccgccatctcgctagcctacgaggaggcagag
agcgatattatgaagcgacaaccacgaaaccccttcactgacaagctagttaatgaaagg
cttatttcgatggcatacggtcaaatcggtatgattcaagccgcggccggctttttcgtc
tactttgtcatcatggctgaaaatggtttcctgcctctgtatctgtttggcattcgaaag
caatgggactctaaggctatcaatgatctcaccgatagctatggtcaggaatggacatat
agagaccgtaaaacgttggagttcacctgccatacagctttcttcgtgtcgatcgtaatt
gtgcagtgggctgatttgattgtttgcaaaacacgtcgcaactctattattcaccaagga
atgagaaactgggctctgaactttggcctcgtgttcgagaccgccctcgctgcgttccta
agttacacgcccggtatggataagggtcttcgtatgttcccactaaaattcgtatggtgg
ctgccagccctgccattcatgtttgctattttcatctacgatgaaacgagacgattctac
ctccgtcgaaatccaggcggctggcttgagcaagaaacttactattag

DBGET integrated database retrieval system