KEGG   Atta cephalotes (leaf cutting ant): 105620717Help
Entry
105620717         CDS       T04923                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00010  Glycolysis / Gluconeogenesis
acep00562  Inositol phosphate metabolism
acep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105620717
   00562 Inositol phosphate metabolism
    105620717
Enzymes [BR:acep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     105620717
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     105620717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 ELM2
Motif
Other DBs
NCBI-GeneID: 105620717
NCBI-ProteinID: XP_012057600
UniProt: A0A158NJ92
Position
Unknown
AA seq 444 aa AA seqDB search
MLWKLFTKILIFCMIADIFLASDYSKHNDSYRCKLGSKTPYRCVANYDESILEYPDCVEK
KIWLIFRHGTRYPGKKYIPRMIEDLPELQHVILKNYKNGATNLSADEAALFKKWKLSFTQ
GNMMKLAVEGENEMIDLGERYQARFPSLMPETFNNQTYKFRFTATQRTEESARHFAVGLF
GWHNSKNVWYPLPVYRDRVIRFYKACPRWRQEVDKNLGAKLEKMKFLDSKIVRNMLDNIK
KRIGLNIDYETVNLMYTTCAFETALNRSIISPWCKIFSSNDFKIFEYVEDLEFYWIDGYG
YPLTYEQACAVLKDMFDFFGSNEATVTTAYFTHSGTILKLIALLGLAKDSHPLMHDSFVL
RKKEDKRAWRSSIIDTFATNIAFVLYDCEYYGPSVLFMLQERPVYLPGCPKDMPCPLNIM
KAIYPDRDEECQFDAMCHITKQGN
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgctttggaaattatttactaaaattcttatattttgtatgatagcagatatttttctt
gcttctgattattccaagcataatgacagttacagatgtaaattaggctcgaaaactcct
tatagatgtgtagctaattatgatgaatcaatattagaatatccagattgtgtggagaaa
aagatttggttgatttttcgtcatggaactcgatatccaggcaagaagtacatacctcgt
atgatagaagacttaccagagctgcaacatgtaatattaaaaaattataagaacggagca
acaaatttgtcagctgatgaagcagctttgtttaaaaaatggaaactatcatttactcaa
ggaaacatgatgaaattggcagtagaaggagaaaatgaaatgattgatcttggagaaaga
tatcaggcaagatttccatctctaatgccagaaacttttaacaatcaaacatataaattt
agattcactgctacacaacgtacagaagagagtgcaagacattttgctgttggtttattc
ggttggcataatagcaaaaatgtttggtatccattaccagtatatcgagatcgagtgata
agattttataaagcttgtcctcgctggcgccaagaagttgacaagaatttaggtgcaaaa
ctagagaaaatgaaatttttggatagcaaaattgttagaaatatgttagacaatattaag
aagcgcattggtctcaatattgattatgaaactgtaaatttaatgtacacaacatgtgct
tttgaaactgctttaaatcgaagtataatatctccctggtgtaaaatattttcatcaaat
gatttcaaaatctttgaatacgtagaagatctagaattctattggatcgatggatatggc
tatccattgacttatgagcaagcgtgcgctgtcttaaaagatatgtttgatttctttgga
tctaatgaagcgacagtgacaacagcttattttacacattccggcacaattttaaaatta
atagccttacttggattagccaaagattcgcatcctttaatgcatgactccttcgtatta
cgcaagaaggaagataaaagagcttggagaagtagtattattgatacatttgcaactaac
atagcatttgttttgtatgattgcgaatattacggacccagtgtcttattcatgcttcag
gaacgaccggtatatttaccaggttgtccgaaagacatgccatgtccattaaatattatg
aaagcgatatatccagatcgcgatgaagaatgtcagtttgatgctatgtgtcatataaca
aaacaaggcaattga

DBGET integrated database retrieval system