KEGG   Atta cephalotes (leaf cutting ant): 105620850Help
Entry
105620850         CDS       T04923                                 

Definition
(RefSeq) insulin-degrading enzyme
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
acep  Atta cephalotes (leaf cutting ant)
Brite
KEGG Orthology (KO) [BR:acep00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:acep01002]
    105620850
Enzymes [BR:acep01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     105620850
Peptidases and inhibitors [BR:acep01002]
 Metallo peptidases
  Family M16: pitrilysin family
   105620850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 105620850
NCBI-ProteinID: XP_012057716
UniProt: A0A158NJK8
Position
Unknown
AA seq 1011 aa AA seqDB search
MLVTRALKSRVLLVSAQSHLLFRNQFSESIAMTNMSTERVEKRCDDIIKSQNDDRLYRGL
VLTNKMKVILISDSTTDKSAVAMDINAGYMCDPDDLPGLAHFCEHMLFLGTKKYPQENDY
NIFLSQNGGTSNASTHLDHTTYYFDVTPEKLEGALDRFAQFFLAPLFTENLTELELNAIN
SEHEKNVANDTWRFDQLDKSSASSDHPFSKFGTGNRETLDTIPKQKGINVRNKLLEFHEK
YYSANIMSLSVLGKESLDELENMVVDLFCEVRNKEIEVPIWPEHPFKDEHFRTMWYIVPI
KDTRNLDISFPLPDMRQHYRSSPEHYVSHLLGHEGEGSLLSALKAKGWCNSLVSGLRPAA
RGFSIFNILVDLTEEGIKHIEDIVLLVFQCINMLKLKGPIKWIYDEYRDIDNINFRFKEK
SSPRTYVKFTVRALQEFPMNEILCAHLVNPEWRPDLIEEIMGYLIPQNVRIHIAAKAYEN
IADEIESWYGTKYKKVKISKEIMDIWNSPGFNDDLKLPPKNEFIATTFDIKPQTNIEKFP
IILEDTSFVRLWYKKDDEFLVPKAKMIFDFFSPFAYMDPLSCNFTYMFIKLFRDSLNEYT
YAADLAGLLWELNSFKYGITLSIGGYDNKQRVLLEKIMDRMINFKVDPKRFEILKEKYIR
SLKNFAAEQPYQHAVYYLVALLAEQAWLKEELLEAATYLNVEGLQQFIPQLLSKVHVECL
IHGNVTVMEATDILKLIESKLTTGVPNIIPLLEQQLVLSREIKLENGCHFLYEAENNLHK
SSCTMVYYPTGLQSTESNMLLELLAQIIAEPCFNTLRTKEQLGYIVFSGIRRSSGAQGLR
IIVQSDKHPQYVEKRINLFLDSMLNHISTMTEEQFEENKKALATLRLEKPKMLIARCTLY
WNEIVTQQYNFDRVNIEVAYLKTISRQQLLNFFKENVHSKNRHKLSVHVISTVSEKSSPD
NTIEKTADLSTDEEVKKIDDILSFKNSQSLYPLVKPLEKYFLRKGVRSSKL
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgttggtcacgcgcgcgttaaaatcccgtgtgctgctcgtgtccgcacaatctcacctg
ctcttcagaaatcaattttctgaatctattgcgatgaccaatatgtcgactgaacgtgtg
gaaaagcgatgtgatgatataataaaatcacaaaatgatgaccgattatatagaggttta
gtactcactaataaaatgaaagttattttaataagcgattcaacaactgataaaagtgct
gttgcaatggacattaatgccggctatatgtgcgatccagatgacctacctggattagcg
cacttttgcgaacatatgttgttcctaggaacgaagaaatatcctcaagagaatgattat
aatatatttctgtcacagaatggtggtacgagtaacgcatcaacacatttagatcacacc
acctattatttcgatgtaactcccgagaaattagaaggtgctttagatcgttttgctcaa
tttttcttagcgcctctttttacggagaacttgactgagctagaactaaatgccataaat
tcagaacacgagaaaaatgtagcgaatgatacatggcgatttgatcaattagacaaatca
tctgcgagctcagatcatccgttttcgaaattcggcacaggaaatagagaaacattagac
acaataccaaaacaaaaaggcattaatgttcgaaataaactactagagtttcatgaaaag
tattattctgcaaatattatgtcactatctgttcttggcaaagagagtttagatgaactt
gaaaatatggtagtggatctgttttgtgaagtacgaaacaaggaaattgaagttccaata
tggcctgaacatccattcaaggatgaacatttccgcactatgtggtacattgttccaata
aaggatacaagaaatttagacatttcgtttcctttaccagacatgcgtcaacattaccgg
tcttcgcctgaacattacgtttctcatttgcttggacatgaaggagaaggctcattatta
tcggctttgaaagctaagggatggtgtaactccttagtatccggactacgtcctgccgcc
agaggcttcagtattttcaatattcttgtcgatttgactgaagaaggtattaagcatatc
gaagatattgttctactggtgtttcagtgtatcaatatgcttaagttgaaaggaccaatc
aaatggatttacgatgaatatagagatattgacaatataaactttcgttttaaagaaaag
tcttcgcctcgtacttatgtgaaatttacggttcgagcgttgcaagaatttcccatgaat
gaaattttgtgcgcgcatcttgttaatcctgaatggcgaccagacttaatcgaagaaata
atgggatatttgattccgcaaaatgttaggattcacatagctgcaaaagcatatgaaaat
atagctgatgaaattgaaagttggtatggcactaaatataagaaagtgaagatatccaag
gaaataatggacatatggaactcccctggctttaacgacgatctgaaattgcctcccaag
aatgaatttatagcaactacatttgatatcaagccacaaactaacattgaaaagtttccc
attattttggaggatacatcatttgtaagactttggtataaaaaggacgatgaatttctt
gtacctaaagcaaagatgatcttcgatttcttcagcccatttgcctatatggatcctctt
agttgcaatttcacttatatgtttattaagctgtttcgtgattctcttaatgaatataca
tatgctgctgatttagctggtttattatgggaacttaatagttttaaatatggaataaca
ctttctataggtggttatgacaacaaacaacgtgtgctgttagaaaaaatcatggatcga
atgataaattttaaagttgatccgaagagatttgaaatcctaaaggaaaaatatatcagg
agcttgaaaaattttgctgctgaacagccttatcaacatgctgtctattatcttgtagcc
ctattagcagagcaagcttggctcaaggaagaattactggaagctgctacctatttaaat
gtcgagggactccagcagtttataccacaactactcagtaaggtgcacgtcgagtgctta
atacatggtaatgtgactgtaatggaagctacagatatacttaaactaattgagtctaag
ttgacaactggagtgcccaacataatacccttgttagaacagcaactagtattgtctcgt
gaaattaaactagaaaatggttgtcactttctgtatgaagcagaaaataatttacataaa
agttcttgtacaatggtatattatccaactggtttacaatcaacagagtcgaatatgctt
ttagagctcttagcacaaattattgcggaaccttgttttaatactttaagaactaaggag
caattaggctacatagtatttagtggtatacgtagatcgagtggagcacaaggcttgcga
atcattgtacaaagtgataaacacccacaatatgtcgaaaaacgaatcaatttattttta
gactccatgttgaatcacatatctaccatgacagaagaacaatttgaagaaaacaagaaa
gctttagctacattacgtttggaaaaaccaaaaatgttaattgcaaggtgtaccttgtat
tggaatgaaattgtgacccaacaatataatttcgatcgagtcaatattgaagtggcttac
ttaaagacgatatcacggcagcaattacttaatttctttaaggaaaatgtacatagtaaa
aatcgacataaattgtcggtacatgtgatatccacagtatcggaaaagagctcacctgat
aacacaatcgaaaaaactgccgatttatcaactgatgaagaagttaagaaaatcgacgat
attttatcatttaaaaatagtcaatctttatatcctctagttaaaccgcttgaaaaatat
tttctcaggaaaggcgtacgctcttctaagttataa

DBGET integrated database retrieval system