KEGG   Atta cephalotes (leaf cutting ant): 105622639Help
Entry
105622639         CDS       T04923                                 

Definition
(RefSeq) histidine decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00340  Histidine metabolism
acep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    105622639
Enzymes [BR:acep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     105622639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 105622639
NCBI-ProteinID: XP_012059444
UniProt: A0A158NPI6
Position
Unknown
AA seq 652 aa AA seqDB search
MDLEDYRQYGKEMVDYIADYLRDIRSRRVYPAVSPGYLRNVLPASAPVDGESWEDIFADV
EKCIMPGVTHWQSPHMHAYFPALNSPASLLGDMLADAINCLGFTWASSPACTELETIIMN
WLGKMIGLPEDFLHQPGGSGGGGVIQTTASEATLVCLLAARTRAIRDVQENDPDCLATEI
NSRLVAYCSDQAHSSVEKAGLIGLVRMRYIKSDSELSMRGDALLESLTRDRAEGLLPFFV
CATLGTTGACSFDNLKEIGPICQQNGLWLHVDAAYAGSAFICPEFRSWLQGVEFTDSIAF
NPSKWLMVHFDCTAMWVKNSQALHRTFNVDPLYLKHENSGLAIDYMHWQIPLSKRFRALK
LWFVIRNYGITGLQKHIREGVRLAQKFEALVLADARFEIPAPRHLGMVVFRLLGENTLTE
RLLKKLNSRGRLHCVPAALHGKYVIRFTVTSTNDLWVIDYNGSVVSSSKDAIISIRRRIR
GILMSGKQFSLDSRMDLVQGYVCSRPLSDSPSELPLMKEDEDAGLSESIFDVDAMDESEN
DKSIVYKNWEDSDNSETTEKELSVSKSDSSYTVTNGSFINIGTKDNGDNTVTIASADVGF
PRSETIAAFGHRPYTGDLVPVRVLEKKLMKENKEDDGKGELCRKCGHYSKRQ
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggatttggaagattatcgccaatatggaaaggaaatggtagattatatcgccgattat
ctgagagacatccgttctcgacgagtatatccagcggtctcgccgggatacttgagaaat
gttctgccggcgtcggcccctgtagacggcgagtcctgggaggacatattcgccgacgtt
gagaaatgcattatgccgggtgtgacgcactggcagagtccgcacatgcacgcctacttt
ccggctctgaattcacctgctagtctactgggcgacatgctggctgacgcaataaactgt
ctgggttttacgtgggcttctagtccagcgtgtactgagttagaaacgatcattatgaat
tggttaggtaaaatgatcggtctacccgaagattttcttcatcaaccgggcggctccggt
ggcggtggcgtcatacaaacgacagcttcagaagccacgttagtgtgtttgcttgcagcc
agaactagagctattagagacgtgcaggagaacgatcctgactgtttggcaacagaaatt
aattcgcgtctagttgcatactgctcggatcaggcacattcaagtgtggagaaagctggc
cttataggactagttcgaatgcgatatattaaatctgacagtgaattaagcatgagagga
gatgctttacttgagtcactaacacgcgaccgagctgagggtctgcttcctttctttgta
tgcgcaaccttaggcacaactggtgcatgttcctttgataatctgaaagaaattggaccg
atatgtcaacaaaatggtttatggttgcatgttgatgcagcctacgctggtagcgctttc
atatgtccggaatttcgaagttggcttcagggagtagagttcactgattctattgccttt
aatcctagcaaatggctcatggtccatttcgattgtacagctatgtgggtaaaaaacagt
caagcgctacacagaacatttaatgtcgatccactatatttaaagcatgaaaattcaggt
cttgcgattgattatatgcattggcaaattcctctatctaaaagatttcgggctttaaaa
ctgtggttcgttatcaggaattatggaattactggcttgcagaaacatatacgagagggc
gtgagactggcacagaagttcgaagctctggtcttggctgacgctcgctttgaaattccc
gctccgagacatctcggcatggtagtctttcgtcttctcggggagaataccttgacagaa
cgtttgttaaagaagcttaactcgcgaggtcgattgcattgcgtgccagcagctttacac
ggcaaatatgttatcagatttacagttacctctacaaacgatttatgggtgattgattac
aatggatcagtagtatcttcatcaaaggacgcgataatttccatacgtcgtcgtattcgc
ggaatattaatgtcaggtaaacaattttcgctggattctcgtatggatctcgttcaggga
tatgtttgcagccgtccactctcggattctccttccgaattaccattaatgaaagaggat
gaagatgccggattaagcgaatcaatatttgatgttgatgcaatggatgaatctgaaaat
gataaatcaattgtttacaaaaattgggaggattctgataattccgaaacaactgagaag
gaattatccgtctcgaagagcgattcgagttatacagtaacgaatggttcattcatcaat
attggtactaaagataacggcgataacacagtgacgattgcttcggccgatgtaggcttt
cctagaagtgaaactatagctgcttttggacatcgtccttatacaggcgatctagtgcct
gtccgagttttggaaaagaagttaatgaaagagaataaagaagatgatggcaagggggag
ctctgcagaaaatgtggtcactactctaaacgtcagtaa

DBGET integrated database retrieval system