KEGG   Atta cephalotes (leaf cutting ant): 105622831Help
Entry
105622831         CDS       T04923                                 

Definition
(RefSeq) 39S ribosomal protein L53, mitochondrial
  KO
K17434  large subunit ribosomal protein L53
Organism
acep  Atta cephalotes (leaf cutting ant)
Brite
KEGG Orthology (KO) [BR:acep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:acep03011]
    105622831
Ribosome [BR:acep03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    105622831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53
Motif
Other DBs
NCBI-GeneID: 105622831
NCBI-ProteinID: XP_012059631
UniProt: A0A158NQ23
Position
Unknown
AA seq 157 aa AA seqDB search
MSIHFSGTIKRSGGMMSAIVKQIKRVNLTPVNKIDVRFDPFDRQSKQTRDFLYYVSAPKI
RATNPQCSLKTEVVCDHSEPTVTFSLQSGEKVVLKTALLTSLNILQLYNKHITSLIPPDP
AELEAKKVLEEEKRKKKKRPHHRIKLWSKHKGVFHLI
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattcatttctctgggaccatcaaacgctccggcggtatgatgagcgcgatcgta
aagcagattaagcgcgtcaacctaacgcctgttaataagatcgatgttcgtttcgacccg
ttcgatcgtcagtccaagcagacgagagattttctgtattacgttagtgctccgaaaatt
cgtgcgacgaacccgcagtgctcattaaaaacagaggtcgtgtgcgaccattccgagcca
accgtcacgttcagtcttcaatcgggtgaaaaagtagtattaaaaacggctcttttaaca
agcctaaacattttgcaactttacaacaagcatatcactagtctgattccacccgatccg
gctgagcttgaggctaaaaaagtgctcgaggaagagaagagaaagaagaaaaagaggccg
catcatagaataaaattatggagcaagcataaaggagtgtttcatttaatctaa

DBGET integrated database retrieval system