KEGG   Atta cephalotes (leaf cutting ant): 105623127Help
Entry
105623127         CDS       T04923                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glucose-6-phosphate 1-dehydrogenase-like
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00030  Pentose phosphate pathway
acep00480  Glutathione metabolism
acep01100  Metabolic pathways
acep01200  Carbon metabolism
Module
acep_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
acep_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:acep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    105623127
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105623127
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acep04147]
    105623127
Enzymes [BR:acep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     105623127
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     105623127
Exosome [BR:acep04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   105623127
  Exosomal proteins of colorectal cancer cells
   105623127
  Exosomal proteins of bladder cancer cells
   105623127
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 105623127
NCBI-ProteinID: XP_012059914
UniProt: A0A158NQV6
Position
Unknown
AA seq 630 aa AA seqDB search
MGDYGTLERNKKTYDAYRHTYCGTDSYIRLCRKETGEGESSRVASKFKDQEWQSIRETNP
TLSRGSAGEVTRLSKEIGKKSAGTHSQSRDXFFVSVPVXLVCKIMNSVMKTMNTLSTSTE
ESLQYIRQSLKSEEMDHLEGTHFDRLIPHVFVTFGASGDLAKKKIYPTLWWLFRDNLLPK
PTTFVGYARSKLTIQQLREKCHPYMKVKSNEEEKYEEFWKLNHYIAGSYDQKKDFEQLNR
KLENFEEGNTAHRLFYLALPPNVYESVTTRIRLTCMGDKGWTRIIIEKPFGRDAASSQKL
SDHLATLFSEDQIYRIDHYLGKEMVQNLMTLRFGNRVFNPTWNRDNVASVQITFKEPFGT
QGRGGYFDEFGIIRDVMQNHLVQILSLVAMEKPASCHPDDIRDEKVKVLRCIKNVQLNQV
VLGQYVGDPNAEDPEARLGYLDDTTVPAGSNTPTFAFAILKINNERWDGVPFILRCGKAL
NERKAEVRVQYQDVPGDIFDGKAKRNELVIRVQPGEALYIKMMTKSPGITFDMEETELDF
TYGSRYKGLKLPDAYERLILDVFCGSQMHFVRNDELHEAWRIFTPLLHQIEKEKILPVPY
KYGSRGPKEADEMAKKHNFAYYGSYKWIKP
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgggagattatgggactctggagaggaacaagaaaacgtatgatgcttatcgccacacg
tattgtggaacggattcgtatattcggctgtgccgaaaggaaaccggtgaaggggaatcg
agcagggtagcgtcaaagttcaaggatcaagaatggcagagcatcagagaaacaaatccg
acgctcagtcgaggttccgctggtgaagtgacgagactatcgaaagaaatcggcaagaaa
tctgctggcactcatagtcaatcacgtgacnnttttttcgtgtctgttcctgtgtgactt
gtttgtaaaattatgaattctgtgatgaaaaccatgaatactttatcgacgtcaacagag
gagagcctgcagtatatcaggcaatccctgaaatcagaagaaatggatcatctggaagga
actcattttgatagactcatcccgcacgtgtttgttacctttggagcatctggtgatctt
gccaagaagaaaatttatccgactctttggtggctcttcagagacaatcttttgccgaaa
ccaactactttcgtcggctacgctagaagtaaattgacaatacaacaattacgtgaaaaa
tgtcatccgtacatgaaagtgaagtcaaacgaagaggagaagtatgaagaattttggaag
ctaaatcattacatcgctggctcttatgatcagaagaaagattttgaacaactgaatcgt
aaattagaaaattttgaggaagggaacactgcacacaggctattttatttggcgttacca
ccaaacgtgtacgaaagcgttacgacacgcattcgacttacatgtatgggagataaagga
tggacgagaattataatcgagaaaccattcggccgtgatgccgcctcgtcacagaaactc
tccgatcatttggcgacgctattcagcgaggatcaaatctaccgtatcgatcattatctc
ggcaaagagatggtgcagaatctgatgactttaagatttggaaacagagtgttcaaccca
acatggaatcgggacaatgtagcctcagtgcaaatcacattcaaagaaccattcggcact
cagggtcgaggcggctatttcgacgagtttggcatcatcagagatgtgatgcagaatcat
ctagtgcaaattttgtccttggtagccatggaaaaacctgcgtcttgccatccggatgat
atcagagacgagaaagtgaaagttctcagatgtatcaaaaatgtgcagcttaatcaggta
gttctcggtcaatacgtcggagatccaaatgctgaggatccggaggcacgtttgggctac
ttggatgataccacagtaccagctggttcgaacacgccgacattcgcgttcgcaatatta
aagataaataatgagagatgggacggcgtaccgttcatcctgagatgtggaaaagcacta
aacgaaagaaaagcagaagtaagagtacagtaccaagatgtaccaggtgatatttttgat
ggaaaggcaaagaggaatgaattagtgataagagtgcaaccaggcgaagcgttgtacatt
aaaatgatgacaaaatcacctggtataacgttcgacatggaagagacggaattggatttc
acttatggtagtagatacaaaggccttaaattaccggatgcctacgagagattaatttta
gatgtcttttgcggttcgcaaatgcattttgtgcgaaacgacgagttgcacgaagcatgg
cggatattcacgccgctgcttcatcaaatcgaaaaagaaaaaattctaccggttccatat
aagtatggctctcggggaccgaaagaagccgacgaaatggcgaagaaacataacttcgcg
tactatggttcatataaatggatcaaaccgtga

DBGET integrated database retrieval system