KEGG   Atta cephalotes (leaf cutting ant): 105624883Help
Entry
105624883         CDS       T04923                                 

Definition
(RefSeq) uncharacterized protein LOC105624883
  KO
K12567  titin [EC:2.7.11.1]
Organism
acep  Atta cephalotes (leaf cutting ant)
Brite
KEGG Orthology (KO) [BR:acep00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acep01001]
    105624883
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acep04131]
    105624883
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:acep04812]
    105624883
   04147 Exosome [BR:acep04147]
    105624883
Enzymes [BR:acep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105624883
Protein kinases [BR:acep01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   105624883
Membrane trafficking [BR:acep04131]
 Others
  Actin-binding proteins
   Others
    105624883
Cytoskeleton proteins [BR:acep04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     105624883
Exosome [BR:acep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105624883
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig Pur_ac_phosph_N Receptor_2B4
Motif
Other DBs
NCBI-GeneID: 105624883
NCBI-ProteinID: XP_012061623
UniProt: A0A158NVR5
Position
Unknown
AA seq 1412 aa AA seqDB search
MGNATTKDYSRSISVGTSSKKTRWDNPGLPAPPGRPILISGTNETQPDLVAIRWERSPSN
GGSAIVGYLIEHRRLGSPHWIRSTSGLCAFPELTLSGLEPGWRYQFRVRAQNALGFSQSS
EVSEPLTVTLQRAAVACAPHFDLELKDTVALENEQTEFVIHFSGTPLPKISWFKDGFEIF
SSRRTRIITDNGKSVLLIHQTALNDEGEIKCTATNRAGHVATKAKLILEASPRIRLPRQY
EDGLLFEQDETIRLKVSLAGRPTPFVTWYHDGELISKDIRHIFEVMDGESVLRIPDAKRN
DRGEYTVKVANKLGEDTASFLVTVTDRPAAPGKIAVAMTLGRSVTLSWKEPEDDGGCKIG
TYIIEYYRIGWEVWLKAVTSRRTTATLTELIEGSEYKFRVKAENPYGVSDPSEESDVIFI
PDIKRRIVTPSLNEKSQSHREISRSRGDKREREVSFTMPAQRTRSLTREEAKIRDDESNS
RFKYDERSASVQRLAMPTSTLDRPSRADSKVTFALDTLEKEEPPIPPVRSREHNSTKQQV
FLRNHTNQSNIAINAKDKQDVITKEETTMTLKSIPTMQVSSPIIEDNITSHFIIKERSLS
PLNVPRIQEYQNEENRTTANYQFLLSSNSIPKKQTVVNELLSLDNLQSQRILQEHDENAL
HGSSEFMLVLYPEDETQEEDISMENSTEIRVKSSINDKQNMIELIEDEDDLIPPPISLSL
PELFSAQHQMVEIMREAVSSTELLHERAMERFYRAVAAEEASETAKQKTQFEKQTKLTLL
DVESVQRPSLRRRLSNSGTTTKNLIISWQAKKNRRRLSEGQTDAASKTLKLLSPVLLLDV
EARSDPNLPSEMIMADPWEKSNKVEFVERLRRWHETTVPLLKEVQQEESIQMYNEEKVII
PSSITVDKVESQSLAQTKETEKEKNISIETSEESSEEISSADSEDLKLLKSRILARQIID
EEDTYHPRGKPIPHVEPELQISYDRLPICEISSLSPIRTVTSASSNNVMPKSILKKPKDE
MTITQNNFGRSIPPEKPIRKALSQSYQQEDIEEINMDTNNKILNLPMSIVSETLKTPTMS
ESDTDSIISAAEAAKSRRMQSKLRSITPEEEAAEIEAKMAVINQYTEIVREYSSHSRHGS
AASSRRSSFSEDQDQKYRVQEKHAPKLIDKQDQNKKLKLKIKNKNEINEEKKDNQASYSK
RESVDARGTTPTRNAMTAKRKSRPNSRDQSPAARRSERIGGTSSRSSSKTRNRTPSKERN
NRSLTKNELNEHDFRRSKISSRPSSRSSSRSSSRERFGTTVPIESKVEKLQKALENSKHR
AMKKEIEETKENARENCFNQANGKLALDAKRTVRSTVSYITDLTLLIAAMYIYFFKKETL
AIPFIVLLLYRKIQEEIHGWMPRRWKRSTKKY
NT seq 4239 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgctaccacgaaagattattcaagaagtatctccgttggcaccagctcgaaa
aaaacgcgttgggataatccaggtcttccggccccaccaggcagacctatcttgatttcg
ggaacgaacgaaacgcagccagatcttgttgcaatacgatgggagagatcaccaagtaat
ggtggatcggcgatcgtcggatacttgatcgaacatcggcgactaggctctcctcattgg
atacgaagcacctccggtctttgtgcttttccagaactaactctcagtgggcttgagcca
ggatggcgttaccaatttcgagtcagagcacaaaacgcacttggattttcacaatcaagc
gaagtctccgaaccactcacagttactttacaaagagccgctgtcgcttgcgctcctcat
ttcgatctagagcttaaagatacggttgcactcgaaaacgaacagactgaatttgtcata
cacttctctggtacaccattgccaaaaatttcatggtttaaagacggtttcgagatcttt
agtagtagacgcactagaattattacggataatggaaaaagtgttctcttgattcatcag
accgcgcttaatgatgagggtgaaattaaatgtaccgccaccaatcgagcaggtcatgtt
gctaccaaagctaaattaattcttgaagcatctccacggatacgattgccacgtcaatat
gaagatggtttactttttgagcaagatgagactattagactgaaagtatctttagcaggt
agaccaacgccttttgtcacctggtatcatgacggagaactgatatccaaagatattaga
catatatttgaagtgatggatggtgaatcagtattgagaataccagatgccaaacgaaat
gatcgaggagaatacactgttaaagtcgcaaataaattaggcgaagatactgcgtctttt
ctagtcactgtgacagatcgacccgctgctcctggtaaaatagctgttgcgatgacacta
ggtagatcggtgacgttgtcgtggaaggaaccagaagatgacggcggatgtaaaatcggg
acttatattatcgagtactacagaattggctgggaggtatggcttaaggcagttacaagc
agacgcacaaccgcaacattaactgaattaatcgaaggttctgaatacaaatttcgtgtg
aaagctgagaatccttacggagtcagtgatccgagtgaagaaagcgatgttattttcatt
ccagacattaaacgaagaatcgtaacaccgtctttgaatgaaaaatcgcaaagtcatcga
gagatcagcagatctcgtggtgataaacgagagagagaggtgagtttcactatgccagcg
caaagaactagaagtctaacaagagaagaagctaaaatccgagacgacgaaagtaatagt
cgctttaaatacgatgagcgatcagcttcggtgcaacgactcgcaatgccaacttctaca
ttggatagaccgtccagagccgatagtaaagtaacatttgcactggatactttggaaaaa
gaagaacctccgattcctccggtcagatcaagagagcacaattccacgaagcaacaagtt
tttcttagaaatcataccaaccaatcaaatattgcgataaatgcgaaagacaagcaagat
gttattacgaaagaagaaacaacaatgacattaaaatcaataccaactatgcaagtctct
tctccaattatcgaagacaatatcacgtcacattttataatcaaagaaaggagtctctct
ccactcaacgtgccaagaattcaagaatatcagaatgaggagaatcgtactacagcgaac
tatcaatttttattatcatcaaattcaattccaaaaaaacagaccgttgtaaacgaatta
ttatcattggataatttgcaatctcagagaatattgcaagagcatgatgagaacgcatta
cacggtagctcggaattcatgcttgttttatatccagaagatgaaacacaagaggaagat
atcagcatggagaactctacagaaattcgagttaaaagcagtataaatgataaacagaat
atgattgagttaatagaagatgaggatgatctcataccaccaccaatatcattatctctt
ccagaattatttagcgcgcagcatcaaatggtggaaataatgcgagaagcggttagctct
actgaacttcttcacgaacgagctatggaacgcttttatcgcgcagttgctgctgaagag
gcatccgaaactgccaaacaaaaaacgcaatttgagaaacaaaccaaactgacactatta
gatgtcgaatctgttcaaagaccatcgcttcgaagacgcttatccaattctggtactact
acgaaaaatttaatcatttcctggcaagccaaaaagaatcgtcgaagattgagcgaagga
caaacagatgcggcatcaaaaacattaaaacttctttcaccagttttgttattggatgtt
gaagctagatcagacccaaatcttccctctgaaatgataatggcagacccttgggaaaag
agcaacaaagtcgaattcgtggaacgtctgcgtagatggcacgaaacgactgtgccgtta
ttaaaagaggtgcaacaagaggagtcgattcaaatgtataatgaagagaaggtgataatt
ccatcatccattactgtggataaagtagaatctcaatcgctggctcaaacaaaggaaaca
gagaaagagaaaaatattagcattgagacttccgaagagtcatcagaagagatcagtagt
gcagacagcgaggatttgaaattattaaaatcaaggattctggcaagacaaattatcgat
gaagaagatacttatcatcctaggggaaaaccaataccacatgtcgaaccagaactacag
atttcgtatgacaggttaccaatttgtgagatttcatctctttcacccatcagaacggtt
acttccgcctcatctaataatgtgatgcccaaatcaatcctaaaaaagcccaaagacgaa
atgacaattactcagaacaattttggtagatcgattcctccagaaaaaccaattaggaag
gcattatcgcaatcgtatcaacaagaagatatagaagagataaatatggatactaataac
aaaattttgaatcttcctatgtctattgtgtccgagactctaaagactcctacgatgtca
gaatcagatacagatagtattatatctgcagcagaagcagcaaaaagtcgaagaatgcaa
tcgaaattgcgatccataacacctgaagaagaagcagccgaaatagaagctaaaatggct
gttataaatcaatatactgagatagtgcgagaatattcgagtcattcacgacacggtagc
gcagccagctctcggagatcttcattttctgaagatcaagatcaaaagtatcgagtacaa
gaaaaacatgcaccaaaattaatagacaaacaagaccagaataagaaattaaaattaaaa
attaaaaataagaatgaaatcaatgaagaaaaaaaagataatcaagcatcgtattctaag
agagaaagcgttgatgctagaggtacgactccaacgagaaatgcgatgactgcgaagcgt
aaaagtagaccaaactccagggaccaatctccagctgcgagaagaagtgaaagaatagga
ggtacttcttcaagatcatcttcgaagaccagaaatcgtacaccttctaaggaaagaaat
aatcgatctttaacaaaaaatgaattgaacgagcatgattttcgtagatctaaaatatct
tctagaccttcctcgcgctcctcatcacgatcaagttctagggaaagatttggaacgaca
gtaccaatagaatcgaaggttgagaaattgcaaaaagcactcgagaatagtaagcatcga
gcaatgaaaaaagaaatagaagaaactaaggagaatgcacgagaaaactgttttaatcaa
gcaaacggaaagttagctttagatgctaaaagaacagtcagatcgaccgtaagctatata
accgacttgacattactaatagctgcaatgtatatttatttctttaaaaaggaaactttg
gcgattccgtttatcgtgcttcttctatatcggaaaatacaagaagaaatacatgggtgg
atgccacgtcgttggaagcgatctaccaagaaatattaa

DBGET integrated database retrieval system